SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000000896 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000000896
Domain Number - Region: 274-343
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0523
Family Myosin rod fragments 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000000896   Gene: ENSPPYG00000000771   Transcript: ENSPPYT00000000927
Sequence length 717
Comment pep:known_by_projection chromosome:PPYG2:1:96539658:96550435:1 gene:ENSPPYG00000000771 transcript:ENSPPYT00000000927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASCLDSDNSWVLAGSESLPVETLGPASRMDPESERALQAPHSPSKADGEELAGTMDGEG
TLFQTESPQSGSILTEETEVKGTLEGDVCGVEPPGPGDTVVQGGLQETTVVTGLGPDTQD
LEGQSPPQSLPSTPKAAWIREEGRCSSSEDDTDVDMEGLRRRRGREAGPPQPMAPLAVEN
QAGGEGAGGELGISLNMCLLGALILLGLGVLLFSGGLSESETGPMEEVERQVLPDPELLD
ALGDRQDGLREQLQASVPPDSVPSLQNMGLLLDKLAKENQDIRLLQAQLQAQKEELQSLM
HQPKWLEEENAQLRGALQQGEAFQRALESELQQLRARLQGLEADCVRGTDGVCLSRGRGP
QGDKAIREQGPREQEPELSFLKQKEQLEAEAQALRQELERQRRLLGSVQQDLERSLQDAS
RGDPAHAGLAELGHRLAQKLQGLENWGQDPGVSANASEAWHQKSHFQNPREWSGKQKWWD
GQRDRKAEHWKHKKEVSGRERKKNWGGQEDREPAGRWKEGKRQGPKEPPRKSGSFHSSGE
KQKQPRWREGAKDNHDPLPSWAELLRPKYRAPQGCSGVDECARQEGLTFFGTELAPVRQQ
ELASLLRTYLARLPWAGQLTKELPLSPAFFGEDGIFRHDRLRFRDFVDALEDSLEEVAVQ
QTGDDDEVDDFEDFIFSHFFGDKALKKRSGKKDKHLQSPRAAGPREGHSHSRHHHRG
Download sequence
Identical sequences H2N5J8
XP_009241829.1.23681 ENSPPYP00000000896 9600.ENSPPYP00000000896 ENSPPYP00000000896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]