SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000001018 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000001018
Domain Number 1 Region: 1-146
Classification Level Classification E-value
Superfamily vWA-like 2.22e-29
Family Integrin A (or I) domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000001018   Gene: ENSPPYG00000000871   Transcript: ENSPPYT00000001052
Sequence length 368
Comment pep:known_by_projection chromosome:PPYG2:1:100330408:100335598:-1 gene:ENSPPYG00000000871 transcript:ENSPPYT00000001052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITLANDCEVLTTLTPDTG
RILSKLHTVQPKGKITFCTGIRVAHLALKHRQGKNHKMRIIAFVGSPVEDNEKDLVKLAK
RLKKEKVNVDIINFGEEEVNTEKLTAFVNTLNGKDGTGSHLVTVPPGPSLADALISSPIL
AGEGGAMLGLGASDFEFGVDPSADPELALALRVSMEEQRQRQEEEARRAAAASAAEAGIA
TTGTEDSDDALLKMTISQQEFGRTGLPDLSSMTEEEQIAYAMQMSLQGAEFGQAESADID
ASSAMDTSEPAKEEDDYDVMQDPEFLQSVLENLPGVDPNNEAIRNAMGSLASQATKDSKK
DKKEEDKK
Download sequence
Identical sequences H2N5W3
ENSPPYP00000001018 9600.ENSPPYP00000001018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]