SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000001025 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000001025
Domain Number 1 Region: 37-522
Classification Level Classification E-value
Superfamily Sema domain 2.88e-136
Family Sema domain 0.000000136
Further Details:      
 
Domain Number 2 Region: 518-544
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000136
Family Plexin repeat 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000001025   Gene: ENSPPYG00000000877   Transcript: ENSPPYT00000001059
Sequence length 932
Comment pep:known_by_projection chromosome:PPYG2:1:100458323:100471239:1 gene:ENSPPYG00000000877 transcript:ENSPPYT00000001059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRAPHFMPLLLLLLLLSLPHTQAAFPQDPLPLLISDLQGTSPLSWFRGLEDDAVAAELG
LDFQRFLTLNRTLLVAARDHVFSFDLQAQEEGEGLVPNKYLTWRSQDVENCAVRGKLTDE
CYNYIRVLVPWDSQTLLACGTNSFSPVCRSYGITSLQQEGEELSGQARCPFDATQSNVAV
FAEGSLYSATAADFQASDAVVYRSLGPQPPLRSAKYDSKWLREPHFVHALEHGDHVYFFF
REVSVEDARLGRVQFSRVARVCKRDMGGSPRALDRHWTSFLKLRLNCSVPGDSTFYFDVL
QALTGPVNLHGRSALFGVFTTQTNSIPGSAVCAFYLDEIERGFEGKFKEQRSLDGAWTPV
SEDRVPSPRPGSCAGVGGAALFSSSRDLPDDVLTFIKAHPLLDPAVPPATHQPLLTLTSR
ALLTQVAVDGMAGPHSNITVMFLGSNDGTVLKVLPPGWRSGGPEPILLEEIDAYSPARCS
GKRTAQTARRIIGLELDTEGHRLFVAFSGCIVYLPLSQCARHGACQRSCLASQDPYCGWH
SSRGCVDIRGPGGTDVDQAGNQESMEHSDCQDGATGSQSGPGDSAYGVRRDLPPASASRS
VPIPLLLASVAAAFALGASVSGLLVSCACRRAHRRRGKDIETPGLPRPLSLRSLARLHGG
GLEPPPPSKDGDAVQTPQLYTTFLPPPEGVPPPELACLPTPESTPELPVKHLRAAGDPWE
WNQNRNNAKEGPGRSRGGHAAGGPAPRVLVRPPPPGCPGQAVEVTTLEELLRYLHGPQPP
RKGAEPPAPLTSRALPPEPAPALLGGPSPRPRPHECAPPLRLDVPPEGRCASAPARPALS
APAPRLGVGGGRRLPFSGHRAPPALLTRVPSGGPSRYSGGPGRHLLYLGRPEGYRGRALK
RVDVEKPQLSPKPPLVGPSSRQAVPNCGRFNF
Download sequence
Identical sequences H2N5W9
XP_003775630.1.23681 XP_009242818.1.23681 ENSPPYP00000001025 ENSPPYP00000001025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]