SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000001029 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000001029
Domain Number - Region: 205-253
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0706
Family TSP-1 type 1 repeat 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000001029   Gene: ENSPPYG00000000881   Transcript: ENSPPYT00000001063
Sequence length 337
Comment pep:known_by_projection chromosome:PPYG2:1:100554962:100555972:-1 gene:ENSPPYG00000000881 transcript:ENSPPYT00000001063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPAAGALLWVLLLSLGPRAAGAQGLTQTPTEMQRVSLRFGGPMTRSYRSTARSGLPRKT
RIILEDENDAMADADRLAGPAAAELLAATVSTSFSRSSAINEEDGSSEEGIVINAGKDNT
SREFPSATPNTAGSSSTRFIANSQEPEIRLTSSLPRSPGRSTEDLPGSEATLSQWSTPGS
TPSRWPSPSPTAMPPPEDLRLVLMPWGPWHCHCKSGTMSRSRAGKLHGLSGRLRVGALSQ
LRTEHKPCTYQQCPCNRLREECPLDTSLCTDTNCASQSTTSTRTTTTPFPTIHLRSSPSL
PPTSPCPALAFWKQVRIGLEDIWNSLSSVFTEMQPVS
Download sequence
Identical sequences H2N5X2
ENSPPYP00000001029 ENSPPYP00000001029 9600.ENSPPYP00000001029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]