SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000001098 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000001098
Domain Number 1 Region: 1-226
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.53e-54
Family FAD/NAD-linked reductases, N-terminal and central domains 0.005
Further Details:      
 
Domain Number 2 Region: 313-486
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.89e-16
Family FAD/NAD-linked reductases, N-terminal and central domains 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000001098   Gene: ENSPPYG00000000944   Transcript: ENSPPYT00000001135
Sequence length 533
Comment pep:known chromosome:PPYG2:1:106436359:106472651:-1 gene:ENSPPYG00000000944 transcript:ENSPPYT00000001135 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKKRIAVIGGGASGLSSIKCCVEEGLEPVCFERTDDIGGLWRFQENPEEGRASIYKSVI
INTSKEMMCFSDYPIPDHYPNFMHNAQVLEYFRMYAKEFDLLKYIRFKTTVCSVKKQPDF
STSGQWEVVTESEGKKEMNVFDGVMVCTGHHTNAHLPLESFPGIEKFKGQYFHSRDYKTP
EGFNGKRVIIIGIGNSGGDLAVEISQTAKQVFLSTRRGAWILNRVGDYGYPADVLFSSRL
TYFMRKICGQSLANKYVERKISQRFDHEMFGLKPKHRALSQHPTVNDDLPNRIISGLVKV
KGNVKEFTETAAIFEDGSREDDIDAVIFATGYSFAFPFLEDSVKVVKNKISLYKKVFPPN
LERPTLAIIGLIQPLGALMPISELQGRWAAQVFKGLKTLPSQSEMMAEISKAQEEIDKRY
VESQRHTIQGDYVDTMEELADLVGVRPNLLSLAFTDPKLALHLLLGPCTPIHYRLQGPGK
WDGARKAILTTDNRIRKPLMTRVVERSSSMTSTMTIGKFMLALAFFAIIIAYF
Download sequence
Identical sequences H2N639
ENSPPYP00000001098 ENSPPYP00000001098 9600.ENSPPYP00000001098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]