SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000001151 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000001151
Domain Number 1 Region: 77-134
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.79e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000001151   Gene: ENSPPYG00000000988   Transcript: ENSPPYT00000001190
Sequence length 135
Comment pep:known_by_projection chromosome:PPYG2:1:112340861:112341268:1 gene:ENSPPYG00000000988 transcript:ENSPPYT00000001190 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMLSPDQAADSDHPSSAHSDPESLGGTDTKVLGSVSDLEPVEEAEGDGKGGSRAALYPHP
QQLSREEKRRRRRATAKYRSAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILR
LAICYISYLNHVLDV
Download sequence
Identical sequences A0A024R0I7 A0A096N6A6 A0A0D9SAD1 A0A1D5QED5 A0A2I2ZAH6 A0A2I3HBP1 A0A2I3T3G4 A0A2K5HJN8 A0A2K5L0C0 A0A2K5UDP9 A0A2K5XT46 A0A2K6GL92 A0A2K6K0A0 A0A2K6NUD6 H2N691 Q02577
ENSMMUP00000011754 ENSMMUP00000011754 ENSPTRP00000001967 9544.ENSMMUP00000011754 9598.ENSPTRP00000001967 9600.ENSPPYP00000001151 9606.ENSP00000322087 ENSPPYP00000001151 ENSP00000322087 ENSPPYP00000001151 GO.81821 gi|161484632|ref|NP_001104531.1| gi|5031945|ref|NP_005590.1| ENSGGOP00000008092 ENSPTRP00000001967 ENSGGOP00000008092 ENSP00000322087 ENSP00000358519 NP_001104531.1.87134 NP_001104531.1.92137 NP_005590.1.87134 NP_005590.1.92137 XP_001112098.1.72884 XP_001148497.1.37143 XP_002810423.1.23681 XP_003805675.1.60992 XP_004026456.1.27298 XP_007975638.1.81039 XP_007975639.1.81039 XP_010366211.1.97406 XP_011788481.1.43180 XP_011856213.1.47321 XP_011938634.1.92194 XP_012355852.1.23891 XP_012355853.1.23891 XP_012513919.1.63892 XP_015286099.1.63531 XP_016780524.1.37143 XP_017725083.1.44346 ENSPANP00000007999 ENSP00000322087 ENSP00000358519 ENSNLEP00000006062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]