SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000001182 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000001182
Domain Number 1 Region: 4-142,176-377
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.57e-54
Family LacY-like proton/sugar symporter 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000001182   Gene: ENSPPYG00000001014   Transcript: ENSPPYT00000001221
Sequence length 431
Comment pep:known chromosome:PPYG2:1:115288313:115333532:1 gene:ENSPPYG00000001014 transcript:ENSPPYT00000001221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEVPISSILVNKYGSRIVMIIGGCLSGCGLIAASFCNTVQQLYFCIGVIGGLGLAFNLN
PALTMIGKYFYKRRPLANGLAMAGSPVFLCTLAPLNQVFFGIFGWRGSFLILGGLLLNCC
VAGALMRPIGPKPTKAGKDKSKASLEKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTI
NQFLDLTLFTHRGFLLYLSGNVIMFFGLFAPLVFLSSYGKSQHYSSEKSAFLLSILAFVD
MVARPSMGLVANTKPIRPRIQYFFAASVVANGVCHMLAPLSTTYVGFCVYAGFFGFAFGW
LSSVLFETLMDLVGPQRFSSAVGLVTIVECCPVLLGPPLLGRLNDMYGDYKYTYWACGVV
LIISGIYLFIGMGINYRLLAKEQKANEQKKENKEEETSIDVAGKPEEFTKAAESPDQKDT
EGGPKEEESPV
Download sequence
Identical sequences H2N6C1
ENSPPYP00000001182 ENSPPYP00000001182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]