SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000001210 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000001210
Domain Number - Region: 94-234
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0549
Family Glycerol-3-phosphate transporter 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000001210   Gene: ENSPPYG00000001041   Transcript: ENSPPYT00000001250
Sequence length 266
Comment pep:known_by_projection chromosome:PPYG2:1:117144786:117159929:1 gene:ENSPPYG00000001041 transcript:ENSPPYT00000001250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWWFQQGLSFLPSALVIWTSAAFIFSYITAVTLHHVDPALPYISDTGTVAPEKCLFGAML
NIAAVLCIATIYVRYKQVHALSPEENVIIKLNKAGLVLGILSCLGLSIVANFQKTTLFAA
HVSGAVLTFGMGSLYMFVQTILSYQMQPKIHGKQVFWIRLLLVIWCGVSAFSMLTFSSVL
HSGNFGTDLEQKLHWNPEDKGYVLHMITTAAEWSMSFSFFGFFLTYIRDFQKISLQVEAN
LHGLTLYDTAPCPINNERTRLLSRDI
Download sequence
Identical sequences H2N6E8
ENSPPYP00000001210 ENSPPYP00000001210 9600.ENSPPYP00000001210 XP_009244751.1.23681 XP_009244755.1.23681 XP_009244759.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]