SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000001299 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000001299
Domain Number - Region: 340-452
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000366
Family Myosin rod fragments 0.0088
Further Details:      
 
Domain Number - Region: 170-398
Classification Level Classification E-value
Superfamily Tropomyosin 0.000687
Family Tropomyosin 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000001299   Gene: ENSPPYG00000001121   Transcript: ENSPPYT00000001343
Sequence length 657
Comment pep:known_by_projection chromosome:PPYG2:1:128375115:128423421:1 gene:ENSPPYG00000001121 transcript:ENSPPYT00000001343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQVLFHQLVPLQVKCKDCEERRVSIRMSIELQSVSNPVHRKDLVIRLTDDTDPFFLYNL
VISEEDFQSLKFQQGLLVDFLAFPQKFIDLLQQCTQEHAKEIPRFLLQLVSPAAILDNSP
AFLNVVETNPFKHLTHLSLKLLPGNDVEIKKFLAGCLKCSKEEKLSLMQSLDDATRQLDF
TQKTLAEKKQELDKLRNEWASHTAALTNKHSQELTNEKEKALQAQVQYQQQHEQQKKDLE
ILHQQNIHQLQNRLSELEAANKDLTERKYKGDSTIRELKAKLSGVEEELQRTKQEVLSLR
RENSTLDVECHEKEKHINQLQTKVAVLEQEIKDKDQLVLRTKEAFDTIQEQKVVLEENGE
KNQVQLGKLEATIKSLSAELLKANEIIKKLQGDLKTLMGKLKLKNTVTIQQEKLLAEKEE
KLQKEQKELQDVGQSLRIKEQEVCKLQEQLEATVKKLEESKQLLKNNEKLITWLNKELNE
NQLVRKQDVLGPSTTPPAHSSSNTIRSGISPNLNVVDGRLTYPACGIGYPVSSAFAFQNT
FPHSISAKNTSHPGSATKVQFNLQFTKPNASLGDVQSGATISMPCSTDKENGENLGLESK
YLKKREDSIPLRGLSQNLFSNSDHQRDGTLGALHTSSKPTVLPSASSAYFPGQLPNN
Download sequence
Identical sequences H2N6N4
ENSPPYP00000001299 XP_002810605.1.23681 9600.ENSPPYP00000001299 ENSPPYP00000001299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]