SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000001348 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000001348
Domain Number 1 Region: 409-470
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000491
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000001348
Domain Number - Region: 964-985,1033-1060
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000111
Family Classic zinc finger, C2H2 0.061
Further Details:      
 
Domain Number - Region: 563-614
Classification Level Classification E-value
Superfamily Expressed protein At2g23090/F21P24.15 0.00432
Family Expressed protein At2g23090/F21P24.15 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000001348   Gene: ENSPPYG00000001164   Transcript: ENSPPYT00000001393
Sequence length 1327
Comment pep:known_by_projection chromosome:PPYG2:1:137821661:137938188:1 gene:ENSPPYG00000001164 transcript:ENSPPYT00000001393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLFLQQDVNKTKSRLNVLNGLANNMDDLKINTDITGAKEELLDDNNFISDKESGVHKPK
DCQTSFQKNNTLTLPEELSKDKSENALSGGQSSLFIHAGAPTVSSENFILPKGAAVNGPV
SHSSLTKTSNMNKGSVPLTTGQPVDQPTTESCSALKVAADLQLSTPQKPSQHQVLFLLSD
VAHAKNPTHSNKKLPTSASVGCDIQNSVGSNIKSDGTLINQVEVGEDGEDLLVKDDCVNT
VTGISSGTDGFRSENDTNWDPQKEFIQFLMTNEETVDKAPPHSKVGLEKKRKRKMDVSKI
TRYTEDCFSDSNCVPNKSKMQEVDFLEQNEELQAVDSQKYALSKVKPESTDEDLESVDAF
QHLIYNPDKCGEESSPVHTSTFLSNTLKKKCEESDSESPATFSTEEPSFYPCTKCNVNFR
EKKHLHRHMMYHLDGNSHFRHLNVPRPYACRECGRTFRDRNSLLKHMIIHQERRQKLMEE
IRELKELQDEGRSARLQCPQCVFGTNCPKTFVQHAKTHEKDKRYYCCEECNFMAVTENEL
ECHRGIAHGAVVKCPIVTSDIAQRKTQKKTFVKDSVVGSSKKSATYVCKMCPFTTSAKSV
LKKHMEYLHSSSCIDSFGSPLGLDKRKNDILEEPVDSDSTKPLTKQQSTTFPKNSALKQD
VKRTFGSTSQSSSFSKIHKRPHRIQKARKSIAQSGVNMCNQNSSPHKNVTIKSSVDQKPK
YFHQAAKEKSNAKANSYYLYRHKYENYRMIKKSGESYPVHFKKEEASSLNSLHLFSSSSN
SHNNFISDPHKPDTKRPESFKDHRRVAVKRVVKESKKESSVGGEDLDSYPDFLHKMTVVV
LQKLNSAEKKDSYETEDESSWDNVELGDYTTQAIEDETYSDINQEHVNLFPLFKSKVEGQ
EPGENATLSYDQNDGFYFEYYEDAGSNNFLHEIHDPQHLETADASLSKHSSVFHWTDLSL
EKKSCPYCPATFETGVGLSNHVRGHLHRAGLSYEARHVVSPEQIATSDKMQHFKRTGTGT
PVKRVRKAIEKSETTSEHTCQLCGGWFDTKIGLSNHVRGHLKRLGKTKWDAHKSPICVLN
EMMQNEEKYEKILKALNSRRIIPRPFVAQKLASSDDFISQNVIPLEAYRNGLKTEALSVS
ASEEEGLNFLNEYDETKPELPSGKKNQSLTLIELLKNKRMGEERNSAISPQKIHNQTARK
RFVQKCVLPLNEDSPLMYQPQKMDLTMHSALDCKQKKSRSRSGSKKKMLTLPHGADEVYI
LRCRFCGLVFRGPLSVQEDWIKHLQRHIVNANLPRTGAGMVEVTSLLKKPASITETSFSL
LMAEAAS
Download sequence
Identical sequences H2N6T2
ENSPPYP00000001348 ENSPPYP00000001348 9600.ENSPPYP00000001348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]