SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000001376 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000001376
Domain Number 1 Region: 307-472
Classification Level Classification E-value
Superfamily vWA-like 4.45e-26
Family Integrin A (or I) domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000001376
Domain Number - Region: 751-795
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00166
Family Fibronectin type III 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000001376   Gene: ENSPPYG00000001186   Transcript: ENSPPYT00000001421
Sequence length 913
Comment pep:known_by_projection chromosome:PPYG2:1:142352108:142391080:-1 gene:ENSPPYG00000001186 transcript:ENSPPYT00000001421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLFRGFVFLLFLCLLHQSNTSFIRLNNNGFEDIIIVIDPSVPEDEKIIEQIEDMVATAS
TYLFEATEKRFFFKNVSILIPENWKENPQYKRPKHENYKHADVIVAPPTLPGRDEPYTKQ
FTECGEKGEYIHFTPDLLLGKKQNEYGPPGRLFVHEWAHLRWGVFDEYNEDQPFYGAKSK
KIEATRCSTGISGRNRVYKCQGGSCLNRACRIDSTTKLYEKDCQFFPEKVQTEKASIMFM
QSIDSVVEFCNEKTHNQEAPSLQNIKCNFRSTWEVISNSEDFKNTTPMVTPPPPPVFSLL
KISQRIVCLVLDKSGSMASYDRLNRMNQAAKHFLLQTVENGSWVGMVHFDSTATIVNKLI
QIISNDERNTLLARLPTYAQGGTSICSGIKYAFQVIRELHSQLDGSEVVLLTDGEDNTAS
SCIDEVKQSGAIVHFIALGTAADEAVIEMSKITGGSHLYASDKAQNNGLIDAFGALTSGN
TDLSQKSLQLESKGLTLNSNPWMNDTVIIDSTVGKDTFFLITWNSLPPSISLWDPSGTIM
ENFTVDATSKMAYLSIPGTAKVGTWAYNLQAKATPETLTITVTSRAANSSVPPITVNAKM
NKDVNSFPSPMIVYAEILQGYVPVLGANVTAFIESQNGHTEVLELLDNGAGADSFKNDGV
YSRYFTAYTENGRYSLKVRAHGGTNTARLRLRPPLNRAAYIPGWVVNGEIEANPPRPEID
EDTQTTLEDFSRTASGGAFVVSQVPSLPLPDQYPPSQITDLDATVHEDEIILTWTAPGDD
FDVGKVQHYIIRISGSILDLRDSFNDALQVNTTDLSPKEANSKEIFAFKPENISEENATH
VFIAIKSIDKSNLTSKVSNIAQVTLFIPQANPDDIDPTPTPDKSHNSGVNISTLILSVIG
SVVIVNFILSTTI
Download sequence
Identical sequences H2N6V7
XP_003775699.1.23681 9600.ENSPPYP00000001376 ENSPPYP00000001376 ENSPPYP00000001376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]