SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000001517 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000001517
Domain Number 1 Region: 539-584
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000301
Family TSP-1 type 1 repeat 0.00085
Further Details:      
 
Domain Number 2 Region: 74-132,193-206,492-530
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000132
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 3 Region: 37-84
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000131
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000001517
Domain Number - Region: 351-392
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0183
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000001517   Gene: ENSPPYG00000001301   Transcript: ENSPPYT00000001565
Sequence length 584
Comment pep:known_by_projection chromosome:PPYG2:1:172716706:172794628:-1 gene:ENSPPYG00000001301 transcript:ENSPPYT00000001565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFAVVFFILSLMTCQPGVTAQEKVNQRVRRTATPAAVTCQLSNWSEWTDCFPCQDKKYRY
RSLLQPNKFGGTICSGDIWDQASCSSSTTCVRQAQCGQDFQCKETGRCLKRHLVCNGDQD
CLDGSDEDDCEDVRAIDEDCSQYEPIPGSQKAALGYNILTQEDAQSVYDASYYGGQCETV
YNGEWRELRYDSTCERLYYGDDEKYFRKPYNFLKYHFEALADTGISSELYDNANDLLSKV
KKDKSDSFGVTIGIGPAGSPLMVGVGVSESEDASFLNELNKYNEKKFIFTRIFTKVQTAH
FKMRRDDIMLDEGMLQSLMELPDQYNYGMYAKFINDYGTHYITSGSMGGTYEYILVIDKA
KMESLGITSRDIMTCFGGSLGIQYEGRINVGGGLSGDHCKKFGDGKTERARKAMAVEDII
SRVRGGHSGWSGGLAHNRSTITYRSWGRSLKYNPVVIDFEMQPIHEVLRHTSLGPLEAKR
QNLRRALDQYLMEFNACRCGPCFNNGVPILEGTSCRCQCRLGHLGPACEQTQTEGAKADG
SWSCWSSWSVCRAGIQERRRECDNPAPQNGGASCPGRKVQMQAC
Download sequence
Identical sequences H2N791
XP_002810818.1.23681 ENSPPYP00000001517 9600.ENSPPYP00000001517 ENSPPYP00000001517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]