SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000001582 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000001582
Domain Number 1 Region: 112-215
Classification Level Classification E-value
Superfamily EF-hand 4.1e-27
Family Eps15 homology domain (EH domain) 0.00000479
Further Details:      
 
Domain Number 2 Region: 218-310
Classification Level Classification E-value
Superfamily EF-hand 8.38e-27
Family Eps15 homology domain (EH domain) 0.00000581
Further Details:      
 
Domain Number 3 Region: 15-105
Classification Level Classification E-value
Superfamily EF-hand 1.93e-20
Family Eps15 homology domain (EH domain) 0.0000116
Further Details:      
 
Domain Number 4 Region: 335-447
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000222
Family Myosin rod fragments 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000001582
Domain Number - Region: 441-493
Classification Level Classification E-value
Superfamily XseB-like 0.0157
Family XseB-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000001582   Gene: ENSPPYG00000001359   Transcript: ENSPPYT00000001632
Sequence length 896
Comment pep:known_by_projection chromosome:PPYG2:1:178252839:178418263:1 gene:ENSPPYG00000001359 transcript:ENSPPYT00000001632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAQLPLTQLSSGNPVYEKYYRQVDTGNTGRVLASDAAAFLKKSGLPDLILGKIWDLA
DTDGKGILNKQEFFVALRLVACAQNGLEVSLSSLNLAVPPPRFHDTSSPLLISGTSAAEL
PWAVKPEDKAKYDAIFDSLSPVNGFLSGDKVKPVLLNSKLPVDILGRVWELSDIDHDGML
DRDEFAVAMFLVYCALEKEPVPMSLPPALVPPSKRKTWVVSPAEKAKYDEIFLKTDKDMD
GFVSGLEVREIFLKTGLPSALLAHIWSLCDTKDCGKLSKDQFALAFHLISQKLIKGIDPP
HVLTPEMIPPSDRASLQKNIVGSSPVADFSAIKELDTLNNEIVDLQREKNNVEQDLKEKE
DTIKQRTSEVQDLQDEVQRENTNLQKLQAQKQQVQELLDELDEQKAQLEEQLKEVRKKCA
EEAQLISSLKAELTSQESQISTYEEELAKAREELSRLQQETAELEESVESGKAQLEPLQQ
HLQDSQQEISSMQMKLMEMKDLENHNSQLNWCSSPHSILVNGATDYCSLSTSSSETANLN
EHAEGQSNLESEPIHQESPARSSPELLPSGVTDENEVTTAVTEKVCSELDNNRHSKEEDP
FNVDSSSLTGPVADTNLDFFQSDPFVGSDPFKDDPFGKIDPFGGDPFKGSDPFASDCFFR
QSTDPFATSSTDPFSAANNSSITSVETLKHNDPFAPGGTVVAASDSVTDPFASVFGNESF
GDGFADFSTLSKVNNEDPFSSATSSSVSNVVITKNVFEETSVKSEDEPPALPPKIGTPTR
PCPPPPGKRSINKLDSPDPFKLNDPFQPFPGNDSPKEKDPEMFCDPFTSATTTTNKEADP
SNFANFSAYPSEEDMIEWAKRESEREEEQRLARLNQQEQEDLELAIALSKSEISEA
Download sequence
Identical sequences H2N7F5
XP_002810874.1.23681 ENSPPYP00000001582 ENSPPYP00000001582 9600.ENSPPYP00000001582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]