SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000001707 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000001707
Domain Number 1 Region: 192-242
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000469
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 2 Region: 1754-1802
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000257
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 3 Region: 638-668
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000164
Family Classic zinc finger, C2H2 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000001707   Gene: ENSPPYG00000001475   Transcript: ENSPPYT00000001763
Sequence length 2406
Comment pep:known_by_projection chromosome:PPYG2:1:188376346:188571662:1 gene:ENSPPYG00000001475 transcript:ENSPPYT00000001763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPEQSVKGTKKAEGSPRKRLTKGEAIQTSVSSSVPYPGSGTAATQESPAQELLAPQPFP
GPSSVLREGSQEKIGQQQKPPKRPPIEASVHISQLPQHPLTPAFMSPGKPEHLLEGSTWQ
LVDPMRPGPSGSFVAPGLHPQSQLLPSHASIIPPEDLPGVPKVFVPRPSQVSLKPTEEAH
KKERKPQKPGKYICQYCSRPCAKPSVLQKHIRSHTGERPYPCGPCGFSFKTKSNLYKHRK
SHAHRIKAGLASGMGGEMYPHGLEMERIPGEEFEEPTEGESTDSEEETSATSGHPAELSP
RPKQPLLSSGLYSSGSHSSSHEHCSLSQSSTAQSLEDPPPFAEPSSEHPLSHKPEDTHTI
KQKLALRLSERKKVIDEQAFLSPGSKGSTESGYFSRSESAEQQVSPPNTNAKSYAEIIFG
KCGRIGQRTAMLTATSTQPLLPLSTEDKPSLVPLSVPRTQVIEHITKLITINEAVVDTSE
IDSVKPRRSSLSRRSSMESPKSGLYREPLSSHSEKTKPEQSLLSLQHPPSTAPPVPLLRS
HSMPSAACTISTPHHPFRGSYSFDDHITDSEALSRSSHVFTSHPRMLKRQPAIELPLGGE
YSSEEPGPSSKDTASKPSDEVEAKESELNKKTKKGLKTKGVIYECNICGARYKKRDNYEA
HKKYYCSELQIAKPISGGTHTSPEAEKSQTEHEPWSQMMHYKLGTTLELTPLRKRRKEKS
LGDEEEPPAFESTKSQFGSPRPSDAARNLPLESMKSPAEPSKSVPSLEGPTGFQPRTPKP
GSSSESGKERRTTSKEISVIQHTSSFEKSDSLEQPSGLEGEDKPLAQFPSPPRAPHGRSA
HSLQPKLVRQPNIQVPEILVTEEPDRPDTEPEPPPKEPEKTEEFQWPQRSQTLAQLPAEK
LPPKKKRLRLAEMAQSSGESSFESSVPLSRSPSQESSVSLSGSSRSASFERDDHGKAEAP
GPSSDTRPKPLGSHMLTVPSHHPHAREMRRSASEQSPNVSHSAHMTETRSKSFDYGSLSL
TGPSAPASVAPPARVAPPERRKCFLVRQASLSRPPESELEAAPKGRQESEEPQPSSSKPS
TKSSLSQISSTVTSHGGPPGGKGPGQDRPPLGPTVPYTEALQVFHHPVAQTSLHEKPYLP
PPVSLFSFQHLVQHEPGQSPEFFSTQAMSSLLSSPYSMPPLPPSLFQAPPLPLQPTVLHP
GQLHLPQLMPHPANIPFRQPPSFLPMPYPASSALSSGFFLPLQSQFALQLPGDVESHLPQ
IKTSLAPLATGSAGLSPSTEYSSDIRLPPVAPPASSSAPTSAPPLALPACPDTMVSLVVP
VRVQTNMPSYGSAMYTTLSQILVTQSQGSLATVALPKFEEPPSKGTTVCGADVHEVGPGP
SGLSEEQSRAFPTPYLRVPVTLPERKGTSLSSESVLSLEGSSSTAGGSKRVLSPAGSLEL
TMETQQQKRVKEEEASKADEKLELVKPCSVVLTSTEDGKRPEKSHLGNQGQGRRDLEMLS
SLSSDPSDTKEIPPLPHPALSHGTAPGSEALKEYPQPSGKPHRRGLPPLSVKKEDSKEQP
DLSSLAPPSSLPLSEMSSRPAKSQEGTDSKKVLQFPSLHTTTNVSWCYLNYIKPNHIQHA
DRRSSVYAGWCISLYNPNLPGVSTKAALSLLRSKQKVSKETYTMATAPHPEAGRLVPSSS
RKPRMTEVHLPSLVSPEGQKELARVEEEEERRGEPEEDAPASQRGEPARIKIFEGGYKSN
EEYVYVRGRGRGKYVCEECGIRCKKPSMLKKHIRTHTDVRPYVCKHCHFAFKTKGNLTKH
MKSKAHSKKCQETGVLEELEAEEGTSDDLFQDSEGREGSEAVEEHQFSDLEDSDSDSDLD
EDEDEDEEESQDELSRPSSEAPPPGPPHALRADSSPILGPQPPDAPASGTEATRGSSVSE
AERLTASSCSMSSQSMPGLPRLGPAPLGSVEKDTGSGLSYKPVSPRRPWSPSKEAGSRPP
LARKHSLTKNDSSPQRCSPAREPQASALSPPGLHVDPGRGMGPLPCGSPRLQLSPLTLRP
LGRELAPRAHVLSKLEGTTDPGLPRYSPTRRWSPGQAESPPRSALPGKWALAGPGSPSAG
EHGSGLGLAPRVLFPPAPLPHKLLSRSPETCASPWQKAESRSPSCSPGPAHPLSARPFST
LHDLHGHIAARTEENIFSHLPLHSQHLTRAPCPLIPIGGIQMVQARPGAHPTLLPGPTAA
WVSGFSGGGSDLTGAREAQERGHWSPTESSSASVSPVAKVSKFTLSSELEGRDYPKERER
TGGGPGRPPDWTPHGTGAPAEPTPTHSPCTPPDTLPRPLQGRRAAQSWSPHLESPRAPAN
PEASATPPLDRSSSVGCLAEASARFPARRRNLSGEPRTRQDSPKLSGSGEPRAPPHQPED
RGSPTA
Download sequence
Identical sequences H2N7S9
ENSPPYP00000001707 ENSPPYP00000001707 9600.ENSPPYP00000001707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]