SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000001729 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000001729
Domain Number 1 Region: 43-238
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 1.22e-76
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.0000108
Further Details:      
 
Domain Number 2 Region: 319-475
Classification Level Classification E-value
Superfamily C-terminal domain of adenylylcyclase associated protein 8.5e-66
Family C-terminal domain of adenylylcyclase associated protein 0.0000000361
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000001729   Gene: ENSPPYG00000001496   Transcript: ENSPPYT00000001785
Sequence length 475
Comment pep:known chromosome:PPYG2:1:190045923:190081013:-1 gene:ENSPPYG00000001496 transcript:ENSPPYT00000001785 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADMQNLVERLERAVGRLEAVSHTSDMHRGYGDSPSKAGAAPYVQVFDSLLAGPVAEYLK
ISKEIGGDVQKHAEMVHTGLKLERALLVTASQCQQPADNKLSDLLAPISEQIKEVITFRE
KNRGSKLFNHLSAVSESIQALGWVAMAPKPGPYVKEMNDAAMFYTNRVLKEYKDVDKKHV
DWVKAYLSIWTELQAYIKEFHTTGLAWSKTGPVAKELSGLPSGPSAGSGPPPPPPGPPPP
PVSTSSGSDESASRSALFAQINQGESITHALKHVSDDMKTHKNPALKAQSGPLRSGPKPF
SAPKPQTSQSPKPATKKEPAVLELEGKKWRVENQENVSNLVIEDTELKQVAYIYKCVNTT
LQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSRDVKVQVMGKVPTISINKTDGCHAYL
SKNSLDCEIVSAKSSEMNVLIPTEGGDFNEFPVPEQFKTLWNGQKLVTTVTEIAG
Download sequence
Identical sequences H2N7V0
XP_009250269.1.23681 XP_009250275.1.23681 XP_009250281.1.23681 9600.ENSPPYP00000001729 ENSPPYP00000001729 ENSPPYP00000001729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]