SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000001731 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000001731
Domain Number 1 Region: 281-362
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.14e-19
Family HLH, helix-loop-helix DNA-binding domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000001731   Gene: ENSPPYG00000001498   Transcript: ENSPPYT00000001787
Sequence length 364
Comment pep:known_by_projection chromosome:PPYG2:1:190207682:190213676:1 gene:ENSPPYG00000001498 transcript:ENSPPYT00000001787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDYDSYQHYFYDYDCGEDFYRSTAPSEDIWKKFELVPSPPTSPPWGLGPGAGDPAPGIGP
LEPWPGGCTGDEAESRGHSKGWGRNYASIIRRDCMWSGFSARERLERAVSDRLAAGAPRG
NPPKASAAPDCTPSLEAGNPAPAAPCPLGEPKTQACSGSESPSDSENEEIDVVTVEKRQS
LGIRKPVTITVRADPLDPCMKHFHISIHQQQHNYAARFPPESCSQEEASERGPQEEVLER
DAAGEKEDEEDEEIVSPPPVESEAAQSCHPKPVSSDTEDVTKRKNHNFLERKRRNDLRSR
FLALRDQVPTLASCSKAPKVVILSKALEYLQALVGAEKRMATEKRQLRCRQQQLQKRIAY
LSGY
Download sequence
Identical sequences H2N7V2
ENSPPYP00000001731 ENSPPYP00000001731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]