SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000001732 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000001732
Domain Number 1 Region: 24-135,223-266
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000136
Family Shikimate kinase (AroK) 0.066
Further Details:      
 
Domain Number 2 Region: 382-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000155
Family HkH motif-containing C2H2 finger 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000001732   Gene: ENSPPYG00000001499   Transcript: ENSPPYT00000001788
Sequence length 467
Comment pep:known_by_projection chromosome:PPYG2:1:190225996:190267540:1 gene:ENSPPYG00000001499 transcript:ENSPPYT00000001788 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASVAAARAIPVGSGLRGLQRTLPLVVILGATGTGKSTLALQLGQRLGGEIVSADSMQVY
EGLDIITNKVSVQEQRICRHHMISFVDPLVTNYTVVDFRNRATALIEDIFARDKIPIVVG
GTNYYIESLLWKVLVNTKPQEMGTEKVIDRKVELEKEDGLVLHKRLSQVDPEMAAKLHPH
DKRKVARSLQVFEETGISHSEFLHRQHTEEGGGPLGGPLKFSNPCILWLHADQAVLDERL
DKRVDDMLAAGLLEELRDFHRRYNQKKVSEDSQDYQHGIFQSIGFKEFHEYLITEGKCTL
ETSNQLLKKGIEALKQVTKRYARKQNRWVKNRFLSRPGPIVPPVYGLEVSDVSKWEESVL
EPALEIVQSFIQGRKPTATPIKMSYNETENKRSYHMCDLCDRIIIGDREWAAHIKSKSHL
NQLKKRRRLDSDAVNTIESQSISPDHDKEPKQKGSPGQNDQELKCSI
Download sequence
Identical sequences H2N7V3
9600.ENSPPYP00000001732 ENSPPYP00000001732 XP_002811043.1.23681 ENSPPYP00000001732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]