SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000001740 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000001740
Domain Number 1 Region: 43-99
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000249
Family HLH, helix-loop-helix DNA-binding domain 0.0032
Further Details:      
 
Domain Number 2 Region: 107-159
Classification Level Classification E-value
Superfamily Orange domain-like 0.000000000222
Family Hairy Orange domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000001740   Gene: ENSPPYG00000001505   Transcript: ENSPPYT00000001796
Sequence length 328
Comment pep:known_by_projection chromosome:PPYG2:1:190471716:190484843:1 gene:ENSPPYG00000001505 transcript:ENSPPYT00000001796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRPKEPSGSDGESDGPIDVGQEGELSQMARPLSTPSPSQMQARKKRRGIIEKRRRDRIN
SSLSELRRLVPTAFEKQGSSKLEKAEVLQMTVDHLKMLHATGGTGFFDARALAVDFRSIG
FRECLTEVIRYLGVLEGPSSHADPVRIRLLSHLNSYAAEMEPSPTPTGPLAFPAWPWSFF
HSCPGLPALSNQLAVLGRVPSPVLPGVSSPAYPIPALRTAPLCRATGIILPARRNVLPSR
GASSTRRARPLERPATPVPVAPSSRAARSSHIAPLLQSSSPTPPGPTGSAAYVAVPAPNS
SSPGPAGRPAGAMLYHSWVSEITEIGAF
Download sequence
Identical sequences H2N7V9
XP_002811046.1.23681 ENSPPYP00000001740 9600.ENSPPYP00000001740 ENSPPYP00000001740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]