SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000001764 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000001764
Domain Number 1 Region: 37-144
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.11e-16
Family Growth factor receptor domain 0.0016
Further Details:      
 
Domain Number 2 Region: 147-200
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000589
Family TSP-1 type 1 repeat 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000001764   Gene: ENSPPYG00000001528   Transcript: ENSPPYT00000001821
Sequence length 263
Comment pep:known_by_projection chromosome:PPYG2:1:192532852:192556467:1 gene:ENSPPYG00000001528 transcript:ENSPPYT00000001821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLGLCVVALVLSWTHLTISSRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKL
FILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYL
HKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKKKLCGFRRGSEERTRRVL
HAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRWENANRNLARKESKEAGAGSR
RRKGQQQQQQQGTVGPLTSAGPA
Download sequence
Identical sequences H2N7Y1
ENSPPYP00000001764 XP_002811074.1.23681 XP_002811075.1.23681 ENSPPYP00000001764 9600.ENSPPYP00000001764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]