SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000001817 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000001817
Domain Number 1 Region: 291-349
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.64e-20
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 2 Region: 235-292
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.28e-18
Family Classic zinc finger, C2H2 0.0097
Further Details:      
 
Domain Number 3 Region: 339-393
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000185
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000001817
Domain Number - Region: 203-248
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00174
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000001817   Gene: ENSPPYG00000001575   Transcript: ENSPPYT00000001875
Sequence length 420
Comment pep:known_by_projection chromosome:PPYG2:1:196902947:196933208:-1 gene:ENSPPYG00000001575 transcript:ENSPPYT00000001875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRSSPSGKGHSRMAEPRFNNPYFWPPPPAMPSQLDNLVLINKIKEQLMAEKIRPPHLPP
TSASSQQPLLVPPAPAESSQAVMSLPKLQQVPGLHPQAVPQPDVALHARPATSTVTGLGL
STRTPSVSTSESSAGTGTGTGTSTPSTPTTTSQSRLIASSPTLISGITSPPLLDSIKTIQ
GHGLLGPPKSERGRKKIKAENPGGPPVLVVPYPILASGETAKEGKTYRCKVCPLTFFTKS
EMQIHSKSHTEAKPHKCPHCSKSFANASYLAQHLRIHLGVKPYHCSYCDKSFRQLSHLQQ
HTRIHTGDRPYKCPHPGCEKAFTQLSNLQSHQRQHNKDKPYKCPNCYRAYSDSASLQIHL
SAHAIKHAKAYCCSMCGRAYTSETYLMKHMSKHTVVEHLVSHHSPQRTESPGIPVRISLI
Download sequence
Identical sequences H2N832
XP_002811145.1.23681 ENSPPYP00000001817 ENSPPYP00000001817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]