SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000001830 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000001830
Domain Number 1 Region: 117-183
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000994
Family Intermediate filament protein, coiled coil region 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000001830   Gene: ENSPPYG00000001587   Transcript: ENSPPYT00000001889
Sequence length 207
Comment pep:known_by_projection chromosome:PPYG2:1:197526022:197539839:1 gene:ENSPPYG00000001587 transcript:ENSPPYT00000001889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EVLTTRATQLSEELAQLRDAYQKQKEQLRQQLEAPPSQRDGHFLQESRRLSAQFENLMAE
SRQDLEEEYEPQLLRLLERKEAGTKALQKTQAEIQEMKEALRPLQAEARQLRLQNRNLED
QIALVRQKRDEEVQQYREQLEEMEERQRQLRNGVQLQQQKNKEMEQLRLSLAEELSTYKA
MLPKSLEQADAPTSQAGGMETQSEGAV
Download sequence
Identical sequences H2N844
9600.ENSPPYP00000001830 ENSPPYP00000001830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]