SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000001876 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000001876
Domain Number 1 Region: 30-221
Classification Level Classification E-value
Superfamily vWA-like 1.67e-54
Family Integrin A (or I) domain 0.00023
Further Details:      
 
Domain Number 2 Region: 262-416
Classification Level Classification E-value
Superfamily vWA-like 5.29e-45
Family Integrin A (or I) domain 0.00048
Further Details:      
 
Domain Number 3 Region: 417-459
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 3.92e-17
Family Chicken cartilage matrix protein 0.00067
Further Details:      
 
Domain Number 4 Region: 221-267
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000306
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000001876   Gene: ENSPPYG00000001625   Transcript: ENSPPYT00000001935
Sequence length 460
Comment pep:known_by_projection chromosome:PPYG2:1:199575064:199584950:1 gene:ENSPPYG00000001625 transcript:ENSPPYT00000001935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVLSGSSLVLCSLLLLLQAPCSPGLAPQSRGHLCRTRPTDLVFVVDSSRSVRPVEFEKV
KVFLSQVIESLDVGPNATRVGMVNYASTVKQEFSLRAHISKAALLQAVRRIQPLSTGTMT
GLAIQFAITKAFSDAEGGRSRSPDISKVVIVVTDGRPQDNVQDVSARARASGVELFAIGV
GRVDKATLRQIASEPQDEHVDYVESYSVIEKLSRKFQEAFCVVSDLCATGDHDCEQVCIS
SPGSYTCACHEGFTLNSDGKTCNQIVDTLDVSDKLAQVGLVQYSSSVRQEFPLGRFHTKK
DIKAAVRNMSYMEKGTMTGAALKYLIDNSFTVSSGARPRAQKVGIVFTDGRSQDYINDAA
KKAKDLGFKMFAVGVGNAVEDELREIASEPVAEHYFYTADFKTINQIGKKLQKKICVEED
PCACESLVKFQAKVEGLLQALTRKLEAVSKRLAILENTVV
Download sequence
Identical sequences H2N888
ENSPPYP00000001876 9600.ENSPPYP00000001876 ENSPPYP00000001876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]