SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000001973 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000001973
Domain Number - Region: 510-616
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00811
Family Myosin rod fragments 0.013
Further Details:      
 
Domain Number - Region: 381-476
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.068
Family Myosin rod fragments 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000001973   Gene: ENSPPYG00000001709   Transcript: ENSPPYT00000002035
Sequence length 664
Comment pep:known_by_projection chromosome:PPYG2:1:204919264:204991359:-1 gene:ENSPPYG00000001709 transcript:ENSPPYT00000002035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRRNADCSKLRRPLKRNRITEGIYGSTFLYLKFLVVWALVLLADFVLEFRFEYLWPFWL
FIRSVYDSFRYQGLAFSVFFVCVAFTSNIICLLFIPIQWLFFAASTYVWVQYVWHTERGV
CLPTVSLWILFVYIEAAIRFKDLKNFHVDLCRPFAAHCIGYPVVTLGFGFKSYVSYKMRL
RKQKEVQKENEFYMQLLQQALPPEQQMLQKQEKEAEEAAKGLPDMDSSILIHHNGGIPAN
KKLSTTLPEIEYREKGKEKDKDAKKHNLGINNNNILQPVDSKIQEIEYMENHINSKRLNN
DLVGSTENLLKEDSCTASSKNYKNASGVVNSSPRSHSATNGSIPSSSSKNEKKQKCTSKS
PSTHKDLMENCIPNNQLSKPDALVRLEQDIKKLKADLQASRQVEQELRSQISSLSSTERG
IRSEMGQLRQENELLQNKLHNAVQMKQKDKQNISQLEKKLKAEQEARSFVEKQLMEEKKR
KKLEEATAARAVAFAAASRGECTETLRNRIRELEAEGKKLTMDMKVKEDQIRELELKVQE
LRKYKENEKDTEVLMSALSAMQDKTQHLENSLSAETRIKLDLFSALGDAKRQLEIAQGQI
LQKDQEIKDLKQKIAEVMAVMPSITYSAATSPLSPVSPHYSSKFVETSPSGLDPNASVYQ
PLKK
Download sequence
Identical sequences A0A096MT58 A0A0D9S867 A0A2K5CYF5 A0A2K5M4Q5 A0A2K5RA38 A0A2K5X0M4 A0A2K6BSN9 H0VLU7 H2N8I4 H2R769 H9FWL6 Q2TLZ1 Q8N5G2
ENSP00000363463 ENSCPOP00000011351 ENSPPYP00000001973 ENSP00000363463 NP_001033737.1.84170 NP_060672.2.87134 NP_060672.2.92137 XP_002811310.1.23681 XP_003471368.1.53824 XP_003809525.1.60992 XP_005544448.1.63531 XP_007978183.1.81039 XP_011761201.1.29376 XP_011935485.1.92194 XP_012295351.1.9421 XP_017390101.1.71028 ENSPPYP00000001973 ENSPTRP00000049985 10141.ENSCPOP00000011351 9600.ENSPPYP00000001973 9606.ENSP00000363463 gi|31542661|ref|NP_060672.2| ENSPTRP00000049985 ENSPANP00000002982 ENSP00000363463 ENSCPOP00000011351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]