SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000002013 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000002013
Domain Number 1 Region: 42-86
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000236
Family HLH, helix-loop-helix DNA-binding domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000002013   Gene: ENSPPYG00000001738   Transcript: ENSPPYT00000002075
Sequence length 119
Comment pep:known_by_projection chromosome:PPYG2:1:206863934:206865825:1 gene:ENSPPYG00000001738 transcript:ENSPPYT00000002075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPR
GTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTTELSPELVISNDKRSFCH
Download sequence
Identical sequences H2N8M4
9600.ENSPPYP00000002013 ENSPPYP00000002013 XP_002811352.1.23681 ENSPPYP00000002013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]