SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000002191 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000002191
Domain Number 1 Region: 201-509
Classification Level Classification E-value
Superfamily Ribonuclease H-like 8.49e-86
Family DnaQ-like 3'-5' exonuclease 0.000000514
Further Details:      
 
Domain Number 2 Region: 505-600
Classification Level Classification E-value
Superfamily HRDC-like 3.92e-24
Family EXOSC10 HRDC domain-like 0.00000437
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000002191   Gene: ENSPPYG00000001891   Transcript: ENSPPYT00000002258
Sequence length 905
Comment pep:known_by_projection chromosome:PPYG2:1:219249245:219281965:1 gene:ENSPPYG00000001891 transcript:ENSPPYT00000002258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGAHASRRVGREALARRAVQAEKMAPPSTREPRVLSATSASKSDEEMVLPGFPDADSFV
KFALGSVVAVTKASGGLPQFGDEYDFYRSFPGFQAFCETQGDRLLQCMSRVMQYHGCRSN
IKDRSKVTELDDKFDLLVDANDVILERVGILLDEASGVNNQPVLAGLQVPKTVVSSWNRK
AAEYGKKAKSETFRLLHAKNIIRPQLKFREKIDNSNTPFLPKIFIKPNAQKPLPQALSKE
RRERPQDRPEDLDVPPALADFIHQQRTQQVEQDMFAHPYQYELNHFTPPDSVLQKPQPQL
YRPIEETPCHFISSLDELVELSEKLLNCQEFAVDLEHHSYRSFLGLTCLMQISTRTEDFI
IDTLELRSDMYILNESLTDPAIVKVFHGADSDIEWLQKDFGLYVVNMFDTHQAARLLNLG
RHSLDHLLKLYCNVDSNKQYQLADWRIRPLPEEMLSYARDDTHYLLYIYDKMRLELWERG
NGQPVQLQVVWQRSRDICLKKFIKPIFTDESYLELYRKQKKHLNTQQLTAFQLLFAWRDK
TARREDESYGYVLPNHMMLKIAEELPKEPQGIIACCNPVPPLVRQINEMHLLIQQAREMP
LLKSEVAAGVKKSGPLPSAERLENVLFGPHDCSHAPPDGYPIIPTNGSVPVQKQTSLFHD
EKEDNLLGTTCLIATAVITLFNEPSAEDNKKGPLTVAQKKAQNIMESFENPFRMFLPSLG
HRAPVSQAAKFDPSTKIYEISNRWKLAQVQVQKDSKETVKKKAAEQTAAREQAKEACKAA
AEQAVSVRQQVALENAAKKRERATSDPRTTEQKQEKKRLKISKKPKDPEPPEKEFTPYDY
SQSDFKAFAGNSKSKVSSQFDPNKQTPSGKKCIAAKKIKQSVGNKSMSFPTGKSDRGFRY
NWPQR
Download sequence
Identical sequences H2N947
ENSPPYP00000002191 ENSPPYP00000002191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]