SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000002254 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000002254
Domain Number 1 Region: 8-70
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000353
Family HLH, helix-loop-helix DNA-binding domain 0.0052
Further Details:      
 
Domain Number 2 Region: 80-123
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000209
Family Hairy Orange domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000002254   Gene: ENSPPYG00000001944   Transcript: ENSPPYT00000002321
Sequence length 173
Comment pep:known_by_projection chromosome:PPYG2:1:224096759:224099084:1 gene:ENSPPYG00000001944 transcript:ENSPPYT00000002321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLPRRAGDAAELRKSLKPLLEKRRRARINQSLSQLKGLILPLLGRENSNCSKLEKADVL
EMTVRFLQELPASSWPTAAPLPCDSYREGYSACVARLARVLPACRVLEPAVSARLLEHLW
RRAASATLDGGRPGDSSGPSAPAPALASAPEPASAPVPSPPSPPCGPGLWRPW
Download sequence
Identical sequences H2N9A9
ENSPPYP00000002254 9600.ENSPPYP00000002254 XP_002811610.1.23681 ENSPPYP00000002254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]