SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000002259 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000002259
Domain Number 1 Region: 3-53
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000051
Family HLH, helix-loop-helix DNA-binding domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000002259   Gene: ENSPPYG00000001947   Transcript: ENSPPYT00000002326
Sequence length 53
Comment pep:known_by_projection chromosome:PPYG2:1:224281475:224281734:-1 gene:ENSPPYG00000001947 transcript:ENSPPYT00000002326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QISKPLMEKKRRARINVSLEQLKSLLEKHYSHQIQKRKLEKADILELSVKYMR
Download sequence
Identical sequences H2N9B4
ENSPPYP00000002259 ENSPPYP00000002259 9600.ENSPPYP00000002259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]