SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000002263 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000002263
Domain Number 1 Region: 906-1175
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.58e-71
Family Tandem AAA-ATPase domain 0.0000319
Further Details:      
 
Domain Number 2 Region: 646-904
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.64e-55
Family Tandem AAA-ATPase domain 0.000049
Further Details:      
 
Domain Number 3 Region: 404-454,482-525
Classification Level Classification E-value
Superfamily Chromo domain-like 2.2e-17
Family Chromo domain 0.021
Further Details:      
 
Domain Number 4 Region: 545-616
Classification Level Classification E-value
Superfamily Chromo domain-like 2.57e-17
Family Chromo domain 0.0044
Further Details:      
 
Domain Number 5 Region: 289-362
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 8.64e-17
Family PHD domain 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000002263
Domain Number - Region: 131-170
Classification Level Classification E-value
Superfamily HMG-box 0.000419
Family HMG-box 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000002263   Gene: ENSPPYG00000001952   Transcript: ENSPPYT00000002331
Sequence length 1856
Comment pep:known_by_projection chromosome:PPYG2:1:224363113:224428180:1 gene:ENSPPYG00000001952 transcript:ENSPPYT00000002331 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEDGGLEAFDDFFPVEPVSLPKKKKPKKLKENKCKGKRKKKEGSNDELSENEEDLEEKSE
SEGSDYSPNKKKKKKLKDKKEKKAKRKKKDEDEDDNDDGCLKEPKSSGQLMAEWGLDDVD
YLFSEEDYHTLTNYKAFSQFLRPLIAKKNPKIPMSKMMTVLGAKWREFSANNPFKGSSAA
AAAAAVAAAVETVTISPPLAVSPPQVPQSVPIRKAKTKEGKGPGVRKKIKASKDGKKKGK
GKKMAGLKFRFGGISSKRKKGSSSEEDEREESDFDSASIHSASVRSECSAALGKKSKRRR
KKKRIDDGDGYETDHQDYCEVCQQGGEIILCDTCPRAYHLVCLDPELEKAPEGKWSCPHC
EKEGIQWEPKDDDDEEEEGGCEEEEDDHMEFCRVCKDGGELLCCDACPSSYHLHCLNPPL
PEIPNGEWLCPRCTCPPLKGKVQRILHWRWTEPPAPFMVGLPGPDVEPSLPPPKPLEGIP
EREFFVKWAGLSYWHCSWVKELQLELYHTVMYRNYQRKNDMDEPPPFDYGSGDEDGKSEK
RKNKDPLYAKMEERFYRYGIKPEWMMIHRILNHSFDKKGDVHYLIKWKDLPYDQCTWEID
DIDIPYYDNLKQAYWGHRELMLGEDTRLPKRLLKKGKKLRDDKQEKPPDTPIVDPTVKFD
KQPWYIDSTGGTLHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTIVFLYSLYKEGH
SKGPYLVSAPLSTIINWEREFEMWAPDFYVVTYTGDKESRSVIRENEFSFEDNAIRSGKK
VFRMKKEVQIKFHVLLTSYELITIDQAILGSIEWACLVVDEAHRLKNNQSKFFRVLNSYK
IDYKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADISKEDQIKKLHDLLGPH
MLRRLKADVFKNMPAKTELIVRVELSQMQKKYYKFILTRNFEALNSKGGGNQVSLLNIMM
DLKKCCNHPYLFPVAAVEAPVLPNGSYDGSSLVKSSGKLMLLQKMLKKLRDEGHRVLIFS
QMTKMLDLLEDFLEYEGYKYERIDGGITGGLRQEAIDRFNAPGAQQFCFLLSTRAGGLGI
NLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKRKMM
LTHLVVRPGLGSKSGSMTKQELDDILKFGTEELFKDDVEGMMSQGQRPVTPIPDVQSSKG
GNLAASAKKKHGSTPPGDNKDVEDSSVIHYDDAAISKLLDRNQDATDDTELQNMNEYLSS
FKVAQYVVREEDGVEEVEREIIKQEENVDPDYWEKLLRHHYEQQQEDLARNLGKGKRIRK
QVNYNDASQEDQEWQDELSDNQSEYSIGSEDEDEDFEERPEGQSGRRQSRRQLKSDRDKP
LPPLLARVGGNIEVLGFNARQRKAFLNAIMRWGMPPQDAFNSHWLVRDLRGKSEKEFRAY
VSLFMRHLCEPGADGAETFADGVPREGLSRQHVLTRIGVMSLVRKKVQEFEHVNGKYSTP
DLIPEGPEGKKPGEVISSDPNTPVPASPAHLLPAPLGLPEEVLPEKEKILDKLELSLIHS
RGDGSELRPDDTKAEEKEPIETQQNGDKEEDDEGKKEDKKGKFKFMFNIADGGFTELHTL
WQNEERAAVSSGKIYDIWHRRHDYWLLAGIVTHGYARWQDIQNDPRYMILNEPFKSEVHK
GNYLEMKNKFLARRFKLLEQALVIEEQLRRAAYLNMTQDPNHPAMALNARLAEVECLAES
HQHLSKESLAGNKPANAVLHKVLNQLEELLSDMKADVTRLPSMLSRIPPVAARLQMSERS
ILSRLTNRAGDPTIQQGAFGSSQMYSNNFGPNFRGPGPGGIVNYNQMPLGPYVTDI
Download sequence
Identical sequences H2N9B8
ENSPPYP00000002263 9600.ENSPPYP00000002263 ENSPPYP00000002263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]