SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000002366 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000002366
Domain Number 1 Region: 282-706
Classification Level Classification E-value
Superfamily Phosphofructokinase 3.14e-108
Family Phosphofructokinase 0.00000709
Further Details:      
 
Domain Number 2 Region: 7-295
Classification Level Classification E-value
Superfamily Phosphofructokinase 7.85e-88
Family Phosphofructokinase 0.00000184
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000002366   Gene: ENSPPYG00000002046   Transcript: ENSPPYT00000002438
Sequence length 718
Comment pep:known chromosome:PPYG2:10:3218634:3262310:1 gene:ENSPPYG00000002046 transcript:ENSPPYT00000002438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVNGGSNIAEADWESVSSILXXGGTIIGSARCQAFRTREGRLKAACNLLQRGITNLCVIG
GDGSLTGANLFRKEWSGLLEELARNGQIDKEAVQKYAYLNVVGMVGSIDNDFCGTDMTIG
TDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFLPESPPEE
GWEEQMCVKLSENRARKKRLNIIIVAEGAIDTQNKPITSEKIKELVVTQLGYDTRVTILG
HVQRGGTPSAFDRILASRMGVEAVIALLEATPDTPACVVSLNGNHAVRLPLMECVQMTQD
VQKAMDERRFQDAVRLRGRSFAGNLNTYKRLAIKLPDDQIPKTNCNVAVINVGAPAAGMN
AAVRSAVRVGIADGHRMLAIYDGFDGFAKGQIKEIGWTDVGGWTGQGGSILGTKRVLPGK
YLEEIATQMRTHSINALLIIGGFEAYLGLLELSAAREKHEEFCVPMVMVPATVSNNVPGS
DFSIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGADAAYIF
EEPFDIRDLQSNVEHLTEKMKTTIQRGLVLRNESCSENYTTDFIYQLYSEEGKGVFDCRK
NVLGHMQQGGAPSPFDRNFGTKISARAMEWITAKLKEARGRGKKFTTDDSVCVLGISKRN
VIFQPVAELKKQTDFEHRIPKEQWWLKLRPLMKILAKYKASYDVSDSGQLEHVQPWSV
Download sequence
Identical sequences H2N9M0
ENSPPYP00000002366 ENSPPYP00000002366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]