SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000002369 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000002369
Domain Number 1 Region: 214-258
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000185
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 2 Region: 247-282
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000772
Family Classic zinc finger, C2H2 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000002369   Gene: ENSPPYG00000002048   Transcript: ENSPPYT00000002441
Sequence length 283
Comment pep:known_by_projection chromosome:PPYG2:10:3901052:3909792:-1 gene:ENSPPYG00000002048 transcript:ENSPPYT00000002441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVLPMCSIFQELQIVHETGYFSALPSLEEYWQQTCLELERYLQSEPCYVSASEIKFDSQ
EDLWTKIILAREKKEESELKISSSPPEDTLITPSFCYNLETNSLNSDVSSESSDSSEELS
PTAKFTSDPIGEVLVSSGKLSSSVTSTPPSSPELSREPSQLWGCVPGELPSPGKVRSGTS
GKPGDKGNGDASPDGRRRVHRCHFNGCRKVYTKSSHLKAHQRTHTGEKPYRCSWEGCEWR
FARSDELTRHFRKHTGAKPFKCSHCDRCFSRSDHLALHMKRHL
Download sequence
Identical sequences H2N9M3
XP_002820522.1.23681 ENSPPYP00000002369 9600.ENSPPYP00000002369 ENSPPYP00000002369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]