SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000002483 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000002483
Domain Number - Region: 326-372
Classification Level Classification E-value
Superfamily Plexin repeat 0.00082
Family Plexin repeat 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000002483   Gene: ENSPPYG00000002135   Transcript: ENSPPYT00000002558
Sequence length 529
Comment pep:known_by_projection chromosome:PPYG2:10:20633897:21140357:1 gene:ENSPPYG00000002135 transcript:ENSPPYT00000002558 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARFPRADLAAAGVVLLCHFFTDQFQFADGKLGDQILDWQYGVAQAFPHTEEEVEVDSHV
YSHRWKRNLDFLKAVDTNRASVGQDSPEPRSFTDLLLDDGQDNNTQIEEDTDHNYYISRI
YGPSDSASRDLWVNIDQMEKDKVKIHGILSNTHRQAARVNLSFDFPFYGHFLREITVATG
GFIYTGEVVHRMLTATQYIAPLMANFDPSVSRNSTVRYFDNGTALVVQWDHVHLQDNYNL
GSFTFQATLLMDGRIIFGYKEIPVLVTQISSTNHPVKVGLSDAFVVVHRIQQIPNVRRRT
IYEYHRVELQMSKITNISAVEMTPLPTCLQFNRCGPCVSSQIGFNCSWCSKLQRCSSGFD
RHRQDWVDSGCPEESKEKMCENTERVETSSRTTTTIGATTTQFRVLTTTRRAVTSQFPTS
LPTEHDTKIALHLKDNGASTDDSAAEKKGGTLHAGLIVGILILVLIIATAILVTVYMYHH
PTSAASIFFIERRPSRWPAMKFRRGSGHPAYAEVEPVGEKEGFIVSEQC
Download sequence
Identical sequences H2N9X6
9600.ENSPPYP00000002483 ENSPPYP00000002483 ENSPPYP00000002483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]