SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000002500 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000002500
Domain Number 1 Region: 257-316
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.36e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000002500   Gene: ENSPPYG00000002150   Transcript: ENSPPYT00000002575
Sequence length 422
Comment pep:known_by_projection chromosome:PPYG2:10:24156822:24159581:1 gene:ENSPPYG00000002150 transcript:ENSPPYT00000002575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPWHAPVDVVIRILACRPSAPASLPQPSPVQRERGPERSGRGHSREARGRAARRPPSCP
QPGPREGGARTGHRNLPRTNTRSPAVPLPTAAASMDTVLLEHFPGGLDAFPSSYFDEDDF
FTDQSSRDPLEDGDELLADEQAEVEFLSHQLHEYCYRDGACLLLQPAPPVAPLALAPPSS
GGPGEPDDGGGGGYCCETGAPPGGFPYSPGSPPSCLAYPCAGAAVLSPGARLRGLSGAAA
AAARRRRRVRSEAELQQLRQAANVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLR
LAIGYINFLSELVQADLPLRGGGAGGCGGPGSGGRLGGDSPGSQAQKVIICHRGTRSPSP
SDPDYGLPPLAGHSLSWTDEKQLKEQNIIRTAKVWTPEDPRKLNSKSSFNNIENEPPFEF
VS
Download sequence
Identical sequences H2N9Z2
ENSPPYP00000002500 ENSPPYP00000002500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]