SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000002560 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000002560
Domain Number 1 Region: 227-469
Classification Level Classification E-value
Superfamily vWA-like 2.45e-84
Family Integrin A (or I) domain 0.000000201
Further Details:      
 
Domain Number 2 Region: 727-815
Classification Level Classification E-value
Superfamily Integrin beta tail domain 4.71e-22
Family Integrin beta tail domain 0.0012
Further Details:      
 
Domain Number 3 Region: 441-557
Classification Level Classification E-value
Superfamily Integrin domains 7.85e-22
Family Integrin domains 0.0011
Further Details:      
 
Domain Number 4 Region: 113-172
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000188
Family Plexin repeat 0.0015
Further Details:      
 
Domain Number 5 Region: 684-725
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000586
Family Integrin beta EGF-like domains 0.0037
Further Details:      
 
Domain Number 6 Region: 643-681
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000781
Family Integrin beta EGF-like domains 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000002560
Domain Number - Region: 609-635
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0279
Family Integrin beta EGF-like domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000002560   Gene: ENSPPYG00000002195   Transcript: ENSPPYT00000002637
Sequence length 887
Comment pep:known chromosome:PPYG2:10:33992284:34058069:-1 gene:ENSPPYG00000002195 transcript:ENSPPYT00000002637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFRRERAAAAASGAGSDAQRRRGSGWFPAGGRLWAAESPPPAPEEEEPPPPAAPETREA
PLARGRGPAGVAEQQVRAHRAEARTPRGEDEFTTDFLDGLISSICCVFAQTDENRCLKAN
AKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGCPPDDIENPRGSKDIKK
NKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEPQTFTLKFKRAEDYPIDLYYLMDL
SYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTSEQ
NCTSPFSYKNVLSLTNKGEVFNELVGKQRISGNLDSPEGGFDAIMQVAVCGSLIGWRNVT
RLLVFSTDAGFHFAGDGKLGGIVLPNDGQCHLENNMYTMSHYYDYPSIAHLVQKLSENNI
QTIFAVTEEFQPVYKELKNLIPKSAVGTLSANSSNVIQLIIDAYNSLSSEVILENSKLSE
GVTISYKSYCKNGVNGTGENGRKCSNISIGDEVQFEISITSNKCPKKDSDSFKIRPLGFT
EEVEVILQYICECECQSEGIPESPKCHEGNGTFECGACRCNEGRVGRHCECSTDEVNSED
MDAYCRKENSSEICSNNGECVCGQCVCRKRDNTNEIYSGKFCECDNFNCDRSNGLICGGN
GVCKCRVCECNPNYTGSACDCSLDTSTCEASNGQICNGRGICECGVCKCTDPKFQGQTCE
MCQTCLGVCAEHKECVQCRAFNKGEKKDTCTQECSYFNITKVESRDKLPQPVQPDPVSHC
KEKDVDDCWFYFTYSVNGNNEVMVHVVENPECPTGPDIIPIVAGVVAGIVLIGLALLLIW
KLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVVNPKYEGK
Download sequence
Identical sequences H2NA51
ENSPPYP00000002560 ENSPPYP00000002560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]