SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000002567 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000002567
Domain Number 1 Region: 243-294
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.00000000000204
Family Leucine zipper domain 0.0000945
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000002567   Gene: ENSPPYG00000002198   Transcript: ENSPPYT00000002644
Sequence length 299
Comment pep:known_by_projection chromosome:PPYG2:10:36232491:36313532:1 gene:ENSPPYG00000002198 transcript:ENSPPYT00000002644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKCARKKYIKTNLRQMTMETVESQHDGSITASLTESKSAHVQTQTGQNSIPALAQVATI
AETDESAESEGVIDSHKRREILSRRPSYRKILNELSSDVPGVPKIEEERSEEEGTPPSIA
TMAVPTSIYQTSTGQYIAIAQGGTIQISNPGSDGVQGLQALTMTNSGAPPPGATIVQYAA
QSADGTQQFFVPGSQVVVQAATGDMPAYQIRAPTAALPQGVVMAASPGSLHSPQQLAEEA
TRKRELRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKVE
Download sequence
Identical sequences H2NA58
ENSPPYP00000002567 XP_009243537.1.23681 ENSPPYP00000002567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]