SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000002572 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000002572
Domain Number 1 Region: 3-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.02e-26
Family KRAB domain (Kruppel-associated box) 0.00093
Further Details:      
 
Domain Number 2 Region: 472-529
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.4e-25
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 3 Region: 388-445
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.58e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 514-566
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.54e-21
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 5 Region: 350-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000178
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 6 Region: 435-467
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000732
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 7 Region: 223-279
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000292
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 8 Region: 269-316
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000556
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000002572   Gene: ENSPPYG00000002202   Transcript: ENSPPYT00000002649
Sequence length 579
Comment pep:known chromosome:PPYG2:10:38167185:38195709:-1 gene:ENSPPYG00000002202 transcript:ENSPPYT00000002649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKSQEQVSFKDVCVDFTQEEWYLLDPAQKILYRDVILENYSNLVSVGYCITKPEVIFKI
EQGEEPWILEKGFPSQCHPERKWKVDDMLESSQENEDDHFWELLFHNNKTVSVENGDRGS
KTFNLGTDPVSLRNYPYKICDSCEMSLKNISGLIISKKNCSRKKPDEFNVCEKLLLDIRH
EKIPIGEKSYKYDQKRNAINYHQDLSQPSFGQSFEYSKNGQGFHDEAAFFTNKRSQIGET
VCKYNECGRTFIESLKLNISQRPHLEMEPYGCSICGKSFCMNLRFGHQRALTKDNPYEYN
EYGEIFCDNSAFIIHQGAYTRKILREYKVSDKTWEKSTVLKHQIVHMGGKSYDYNENGSN
FSKKSHLTQLRRAHTGEKTFECGECGKTFWEKSNLTQHQRTHTGEKPYECTECGKAFCQK
PHLTNHQRTHTGEKPYECKQCGKTFCVKSNLTEHQRTHTGEKPYECNACGKSFCHRSALT
VHQRTHTGEKPFICNECGKSFCVKSNLIVHQRTHTGEKPYKCNECGKTFCEKSALTKHQR
THTGEKPYECNACGKTFSQRSVLTKHQRIHMRVKALSTS
Download sequence
Identical sequences H2NA63
ENSPPYP00000002572 9600.ENSPPYP00000002572 XP_009243567.1.23681 XP_009243568.1.23681 XP_009243569.1.23681 XP_009243570.1.23681 ENSPPYP00000002572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]