SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000002590 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000002590
Domain Number 1 Region: 281-338
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.51e-23
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 65-125
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-23
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 3 Region: 337-394
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.7e-23
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 393-450
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.46e-21
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 5 Region: 439-491
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.46e-19
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 6 Region: 225-282
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.83e-16
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 7 Region: 187-239
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.35e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000002590   Gene: ENSPPYG00000002215   Transcript: ENSPPYT00000002667
Sequence length 500
Comment pep:known_by_projection chromosome:PPYG2:10:42175454:42186649:1 gene:ENSPPYG00000002215 transcript:ENSPPYT00000002667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPVSAWWERCTRPWLVVTVGTAWCGRCLSGRAAPQPCRLGSIDLRRILCPCLGEQFRRQM
APRAQIQGPLTFGDVAVAFTRIEWRHLDAAQRALYRDVMLENYGNLVSVGLLSSKPKLIT
QLEQGAEPWTEVREAPSGTHTVQDYWFETKMSALKQSTSEGSVLGERTKTVMMEKGLDWE
GRSSTEKNYKCKECGKVFKYNSSFISHQRNHTSEKPHKCKECGIAFMNSSSLLNHHKVHA
GKQPYRCIECGKFLKKHSTFINHQRIHSREKPHKCIECGKTFRKNSILLSHQRIHTGQKP
YKCNDCGKAFAQNAALTRHERIHSGEKPFKCNKCGRAFRDNSTVLEHQKIHTGEKPYQCN
ECGKAFRKSSTLISHQRMHTGEKPYHCSKCGKSFRYSSSFAGHQKTHSGNKPYQCRDCGK
AFTKSSTLTGHQRIHTGEKPYHCKKCGKAFRHSSGLVEHQRLHTGEKPYKCNECGKAFPR
SSALKQHKKIHNKERAMECS
Download sequence
Identical sequences H2NA81
ENSPPYP00000002590 ENSPPYP00000002590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]