SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000002591 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000002591
Domain Number 1 Region: 168-225
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.67e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 112-169
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.32e-23
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 3 Region: 210-262
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.41e-16
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 4 Region: 75-126
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000202
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000002591   Gene: ENSPPYG00000002216   Transcript: ENSPPYT00000002668
Sequence length 272
Comment pep:known_by_projection chromosome:PPYG2:10:42223608:42228444:-1 gene:ENSPPYG00000002216 transcript:ENSPPYT00000002668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGFPTATLLDCHGRYAQNVAFFNVMTEAHHKYDHSEATGSSSWDIQNSFRREKLEQKSP
DSKTLQEDSPGVRQRVYECQECKSFRQKGSLTLHERIHTGQKPFECTHCGKSFRAKGNLV
THQRIHTGEKPYQCKECGKSFSQRGSLAVHERLHTGQKPYECAICQRSFRNQSNLAVHRR
VHSGEKPYRCDQCGKAFSQKGSLIVHIRVHTGLKPYACTQCRKSFHTRGNCILHGKIHTG
ETPYLCGQCGKSFTQRGSLAVHQRSCSQRLTL
Download sequence
Identical sequences H2NA82
ENSPPYP00000002591 9600.ENSPPYP00000002591 ENSPPYP00000002591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]