SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000002748 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000002748
Domain Number 1 Region: 258-457
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.1e-48
Family Reprolysin-like 0.002
Further Details:      
 
Domain Number 2 Region: 551-601
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000116
Family TSP-1 type 1 repeat 0.00034
Further Details:      
 
Domain Number 3 Region: 908-967
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000811
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 4 Region: 970-1020
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000811
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 5 Region: 846-905
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000122
Family TSP-1 type 1 repeat 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000002748   Gene: ENSPPYG00000002367   Transcript: ENSPPYT00000002842
Sequence length 1222
Comment pep:known_by_projection chromosome:PPYG2:10:64526196:64618695:-1 gene:ENSPPYG00000002367 transcript:ENSPPYT00000002842 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPLRALLSCLLPLHCALCAAAGSGTKLHLSGKLSDYGVTVPCSTDFRGRFLSHVVSGPA
AASAGSMVVDTPPTLPRHSSHLRVARSPLHPGGTLWPGRAGRHSLYFNVTVFGKELHLRL
RPNQRLVVPGSSVEWQEDFRELFRQPLRQECVYTGGVTGMPGAAVAISNCDGLAGLIRTD
STDFFIEPLERGQQEKEPSGRTHVVYRREAVRQEWAEPHGDLHNEAFGLGDLPNLLGLVR
DQLGDTERKRRHAKPGSYSIEVLLVVDDSVVRFHGKEHVQNYVLTLMNIVDEIYHDESLG
VHINIALVRLIMVGYRQSLSLIERGNPSRSLEQVCRWAHSQQRQDPGHAEHHDHVVFLTR
QDFGPSGYAPVTGMCHPLRSCALNHEDGFSSAFVIAHETGHVLGMEHDGQGNGCAEETSL
GSVMAPLVQAAFHRFHWSRCSKLELSRYLPSYDCLLDDPFDPAWPQPPELPGIDYSMDEQ
CRFDFGSGYQTCLAFRTFEPCKQLWCSHPDNPYFCKTKKGPPLDGTECAPGKWCFKGHCI
WKSPEQTYGQDGGWSSWTKFGSCSRSCGAGVRSRSRSCNNPSPAYGGRPCLGPMFEYQVC
NSEECPGPYEDFRAQQCAKRNSYYVHQNAKHSWVPYEPDDDAQKCELICQSADTGDVVFM
NQVVHDGTRCSYRDPYSVCARGECVPVGCDKEVGSMKADDKCGVCGGDNSHCRTVKGTLG
KASKQAGALKLVQIPAGARHIQIEALEKSPHRIVVKNQVTGSFILNPKGKEATSRTFTAM
GLEWEDAVEDAKESLKTSGPLPEAIAILVLPPTEGGPRSSLAYKYVIHEDLLPLIGSNNV
LLEEMDTYEWALKSWAPCSKACGGGIQFTKYGCRRRRDHHMVQRHLCDHKKRPKPIRRRC
NQHPCSQPVWVTEEWSACSRSCGKLGVQTRGIQCLLPLPNGTHKVMPAKACPGDRPEARR
PCLRVPCPAQWRLGAWSQCSATCGEGIQQRQVVCRTNANSLGQCEGDRPDTVQVCSLPAC
GGNRQNSTVRADVWELGTPEGQWVPQSGPLHPINKISSTELCTGDRSVFCQLEVLDRYCS
IPGYHRLCCVSCIKKASGPNPGPDSGPTSLPPFSTPGSPLPGPQDPADAVEPPGKPTGSE
DHQHGQATQLPGALDTSSPGTQHPFAPETPIPGASWSISPTTPGGLPWGWTQTPTPVPED
KGQPGEDLRHPGTSLPAASPVT
Download sequence
Identical sequences H2NAN0
ENSPPYP00000002748 ENSPPYP00000002748 9600.ENSPPYP00000002748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]