SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000002812 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000002812
Domain Number - Region: 56-167
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.018
Family Myosin rod fragments 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000002812   Gene: ENSPPYG00000002424   Transcript: ENSPPYT00000002911
Sequence length 474
Comment pep:known_by_projection chromosome:PPYG2:10:75902285:76019129:1 gene:ENSPPYG00000002424 transcript:ENSPPYT00000002911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADSASESDTDGAGGNSSSSAAMQSSCSSTSGGGGGGGGGGGGGKSGGIVISPFRLEELT
NRLASLQQENKVLKIELETYKLKCKALQEENRDLRKASVTIQARAEQEEEFISNTLFKKI
QALQKEKETLAVNYEKEEEFLTNELSRKLMQLQHEKAELEQHLEQEQEFQVNKLMKKIKK
LENDTISKQLTLEQLRREKIDLENTLEQEQEALVNRLWKRMDKLEAEKRILQEKLDQPVS
APPSPRDISMEIDSPENMMRHIRFLKNEVERLKKQLRAAQLQHSEKMAQYLEEERHMREE
NLRLQRKLQREMERREALCRQLSESESSLEMDDERYFNEMSAQGLRPRTVSSPIPYTPSP
SSSRPISPGLSYASHTVGFTPPTSLTRAGMSYYNSPGLHVQHMGTSHGITRPSPRRSNSP
DKFKRPTPPPSPNTQTPVQPPPPPPPPPMQPTVPSAATSQPTPSQHSAHPSSQP
Download sequence
Identical sequences A0A2I2Y434 H2NAU2 H2QZY4 Q16204
ENSPTRP00000039794 ENSPPYP00000002812 NP_005427.2.87134 NP_005427.2.92137 XP_002820960.1.23681 XP_018890878.1.27298 XP_521482.2.37143 ENSPTRP00000039794 ENSP00000263102 ENSPPYP00000002812 gi|46852390|ref|NP_005427.2| 9600.ENSPPYP00000002812 9606.ENSP00000263102 ENSP00000263102 ENSP00000263102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]