SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000002837 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000002837
Domain Number 1 Region: 1-209,301-337
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.57e-20
Family FAD-linked reductases, N-terminal domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000002837   Gene: ENSPPYG00000002447   Transcript: ENSPPYT00000002937
Sequence length 342
Comment pep:known_by_projection chromosome:PPYG2:10:85825190:86141525:1 gene:ENSPPYG00000002447 transcript:ENSPPYT00000002937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARVLIVGAGVTGSLCAALLRRQTSGPLYLAVWDKAEDSGGRMTTASSPHNPQCTADLGA
QYVTCTPHYAKKHQRFYDELLAYGVLRPLTSPIEGMVMKEGDCNFVAPQGISSIIKHYLK
ESGAEVYFRHRVTQINLRNDKWEVSKQTGSPEQFDLIVLTMPVPQILQLQGDITNLISEC
QRQQLEAVSYSSRYALGLFYEAGTNIDVPWAGQYITSNPCIRFISIDNKKRNIESSEIGP
SLVIHTTVPFGVTYLEHSIEDVQELIFQQLENILPGLPQPIATKCQKWRHSQVTNAAANC
PGQMTLHHKPFLACGGDGFTQSNFDGCITSALCVLEALKNYI
Download sequence
Identical sequences H2NAW7
ENSPPYP00000002837 ENSPPYP00000002837 9600.ENSPPYP00000002837 XP_002820985.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]