SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000002890 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000002890
Domain Number 1 Region: 467-818
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.43e-113
Family PDEase 0.000000248
Further Details:      
 
Domain Number 2 Region: 55-252
Classification Level Classification E-value
Superfamily GAF domain-like 2.18e-31
Family GAF domain 0.00053
Further Details:      
 
Domain Number 3 Region: 238-283,323-443
Classification Level Classification E-value
Superfamily GAF domain-like 3.36e-25
Family GAF domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000002890   Gene: ENSPPYG00000002494   Transcript: ENSPPYT00000002991
Sequence length 842
Comment pep:known_by_projection chromosome:PPYG2:10:92376120:92428575:1 gene:ENSPPYG00000002494 transcript:ENSPPYT00000002991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEINQDAVEKYLEENPQFAKEYFERKLRVEVLGEIFKNSQVPVQSSMSFSELTQVEESA
LCLELLWTVQEEGGTPEQGVHRALQRLAHLLQADRCSMFLCRSRNGIPEVASRLLDVTPT
SKFEDNLVGPDKEVVFPLDIGIVGWAAHTKKTHNVPDVKKNSHFSDFMDNQTGYVTKNLL
ATPIVVGKEVLAVIMAVNKVNASEFSKQDEEVFSKYLNFVSIILRIHHTSYMYNIESRRS
QILMWSANKVFEELTDVERQFHKALYTVRTYLNCERYSIGLLDMTKEKEFYDEWPIKLGE
VEPYKGPKTPDGREVNFYKIIDYILHGKEEIKVIPTPPADHWTLISGLPTYVAENGFKGP
VDETGWVIKNVLSLPIVNKKEDIVGVATFYNRKDGKPFDEHDEYITETLTQFLGWSLLNT
DTYDKMNKLENRKDIAQEMLMNQTKATPDEIKSILKFQEKLNVDVIDDCEEKQLVAILKE
DLPDPRSAELYEFRFSDFPLTEHGLIKCGIRLFFEINVVEKFKVPVEVLTRWMYTVRKGY
RAVTYHNWRHGFNVGQTMFTLLMTGRLKKYYTDLEAFAMLAAAFCHDIDHRGTNNLYQMK
STSPLARLHGSSILERHHLEYSKTLLQDESLNIFQNLNKRQFETVIHLFEVAIIATDLAL
YFKKRTMFQKIVDACEQMQTEEEAIKYVTVDPTKKEIIMAMMMTACDLSAITKPWEVQSQ
VALMVANEFWEQGDLERTVLQQQPIPMMDRNKRDELPKLQVGFIDFVCTFVYKEFSRFHK
EITPMLSGLQNNRVEWKSLADEYDAKMKVIEEEAKKQEGGAEKAAEDSGGGDDKKSKTCL
ML
Download sequence
Identical sequences H2NB20
9600.ENSPPYP00000002890 XP_002821045.1.23681 ENSPPYP00000002890 ENSPPYP00000002890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]