SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000002955 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000002955
Domain Number 1 Region: 30-136
Classification Level Classification E-value
Superfamily SRCR-like 7.72e-39
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00017
Further Details:      
 
Domain Number 2 Region: 348-465
Classification Level Classification E-value
Superfamily SRCR-like 4.19e-24
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0013
Further Details:      
 
Domain Number 3 Region: 172-293
Classification Level Classification E-value
Superfamily SRCR-like 5.36e-22
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0047
Further Details:      
 
Domain Number 4 Region: 308-340
Classification Level Classification E-value
Superfamily SRCR-like 0.00000798
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000002955   Gene: ENSPPYG00000002546   Transcript: ENSPPYT00000003058
Sequence length 685
Comment pep:known_by_projection chromosome:PPYG2:10:97228498:97249752:-1 gene:ENSPPYG00000002546 transcript:ENSPPYT00000003058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWSPPATLSLFLLLLGQPPPSRPQSLGTTKLRLVGPESKPEEGRLEVLHQGQWGTVCDD
NFAIQEATVACRQLGFEAALTWAHSAKYGQGEGPIWLDNVRCVGTESSLDQCRSNGWGVS
DCSHSEDVGVICHPRRHRGYLSETVSNALGSQGRRLEEVRLKPILASAKQHSPVTEGAVE
VKYEGHWRQVCDQGWTMNNSRVVCGMLGFPSEVPVDSHYYRKVWDLKMRDPKSRLKSLTN
KNSFWIHQVTCLGTEPHMANCQVQVAPARGKLRPACPGGMHAVVSCVAGPRFRPLKTKPQ
RKGSRAERCRGYERTLSDCPALEGSQNGCQHENDAAVRCNVPNMGFQNQVRLAGGRIPEE
GLLEVQVEVNGVPRWGSVCSENWGLTEAMVACRQLGLGFAIHAYKETWYWSGTPRAQEVV
MSGVRCSGTELALQQCQRHGPVHCSHGGGRFLAGVSCMDSAPDLVMNAQLVQETAYLEDR
PLSQLYCAHEENCLSKSADHMDWPYGYRRLLRFSTQIYNLGRTDFRPKTGRDSWVWHQCH
RHYHSIEVFTHYDLLTLNGSKVAEGHKASFCLEDTNCPTGLQRRYACANFGEQGVTVGCW
DTYRHDIDCQWVDITDVGPGNYIFQVIVNPHYEVAESDFSNNMLQCRCKYDGHRVWLHNC
HIGNSYPANAELSLEQEQRLRNNLI
Download sequence
Identical sequences H2NB84
ENSPPYP00000002955 ENSPPYP00000002955 9600.ENSPPYP00000002955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]