SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000002989 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000002989
Domain Number 1 Region: 36-473
Classification Level Classification E-value
Superfamily Sema domain 2.88e-135
Family Sema domain 0.0000000232
Further Details:      
 
Domain Number 2 Region: 476-514
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000392
Family Plexin repeat 0.0012
Further Details:      
 
Domain Number 3 Region: 541-630
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000027
Family I set domains 0.025
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000002989
Domain Number - Region: 739-747
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0706
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000002989   Gene: ENSPPYG00000002574   Transcript: ENSPPYT00000003093
Sequence length 811
Comment pep:known_by_projection chromosome:PPYG2:10:99995351:100007381:1 gene:ENSPPYG00000002574 transcript:ENSPPYT00000003093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWGRLWPLLLSILTATAVPGPSLRRPSRELDATPRMTIPYEELSGTRHFKGQAQNYSTLL
LEEASARLLVGARGALFSLSANDIGDGAHKEIHWEASPEMQSKCHQKGKNNQTECFNHVR
FLQRLNSTHLYACGTHAFQPLCAAIGGLYTATRYEFRSIPDIRRSRHPHSLRTEETPMHW
LNDAEFVFSVLVRESKASAVGDDDKVYYFFTERATEEGSGSFTQSRSSHRVARVARVCKG
DLGGKKILQKKWTSFLKARLICHIPLYETLRGVCSLYAETSSRTHFYAAFTLSTQWKTLE
ASAICRYDLAEIQAVFAGPYMEYQDGSRRWGRYEGGVPEPRPGSCITDSLRSQGYNSSQD
LPSPVLDFVKLHPLMARPVVPTRGRPLLLKRNVRYTHLTGTPVTTPAGPTYDLLFLGTAD
GWIHKAVVLGPGMHIIEETQVFREPQSVENLVISLLQHSLYVGAPSGVIQLPLSSCSRYR
SCYDCILARDPYCGWDPDTHACAAATTIANRSQGSRTALIQDIERGNRGCEKKRDTGPPP
PLKTRSVLRGDDVLLPCDQSSNLARALWLLNGSMGLSDGQGGYRVGVDGLLVTDAQPAHS
GNYGCYAEENGLRTLLASYSLTVRPATPAPAPKAPATPGAQLAPDVRLLYVLAIAALGGL
CLILASSLLYVACLREGRRGRRRKYSLGRASRAGGSAVQLQTVSGQCPGEEDPGEDEGAG
GLEGSCLQIIPGEGAPALPPPPPPPPPAELTNGLVALPSRLRRMNGNSYMLLRQSNIGVL
AGPCSFAEELSRILEKRKHTQLVEQLDESSV
Download sequence
Identical sequences H2NBB8
ENSPPYP00000002989 ENSPPYP00000002989 9600.ENSPPYP00000002989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]