SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003098 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000003098
Domain Number 1 Region: 285-366
Classification Level Classification E-value
Superfamily HMG-box 1.24e-21
Family HMG-box 0.00000521
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000003098
Domain Number - Region: 126-254
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00392
Family beta-sandwich domain of Sec23/24 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003098   Gene: ENSPPYG00000002661   Transcript: ENSPPYT00000003204
Sequence length 430
Comment pep:known_by_projection chromosome:PPYG2:10:112290268:112511891:1 gene:ENSPPYG00000002661 transcript:ENSPPYT00000003204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVNESETNQNSSS
DSELHFQSGSTHYSAYKTIEHQIAVQYLQMKWPLLDVQAGSLQSRQALKDARSPSPAHIV
SNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYP
LSPGTVGQIPHPLGWLVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPPHHTL
HTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPHIKKPLNAFMLYMKEM
RAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYG
KKKKRKRDKQPGETNEHSECFLNPCLSLPPITDLSAPKKCRARFGLDQQNNWCGPCRCKY
SKEVSGTVRA
Download sequence
Identical sequences H2NBL9
ENSPPYP00000003098 ENSPPYP00000003098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]