SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003106 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000003106
Domain Number 1 Region: 59-302
Classification Level Classification E-value
Superfamily Caspase-like 5.53e-95
Family Caspase catalytic domain 0.000000000218
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003106   Gene: ENSPPYG00000002664   Transcript: ENSPPYT00000003212
Sequence length 304
Comment pep:known_by_projection chromosome:PPYG2:10:113066437:113120411:1 gene:ENSPPYG00000002664 transcript:ENSPPYT00000003212 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMADDQGCVEEQGLGDSANEDSVDAKPDRSSFVPFLFSMKKKNVSMQSIKTTRDRVPTYQ
YNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKM
QDLLKKASEEDHTNAACFACILLSHGEENLIYGKDGVTPIKDLTAHFRGDRCKTLLEKPK
LFFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGS
WFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPRFHEKKQIPCVVSMLTKEL
YFSQ
Download sequence
Identical sequences H2NBM7
ENSPPYP00000003106 ENSPPYP00000003106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]