SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003117 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000003117
Domain Number 1 Region: 20-189
Classification Level Classification E-value
Superfamily vWA-like 2.36e-48
Family Integrin A (or I) domain 0.00068
Further Details:      
 
Domain Number 2 Region: 490-681
Classification Level Classification E-value
Superfamily vWA-like 1.53e-41
Family Integrin A (or I) domain 0.0007
Further Details:      
 
Domain Number 3 Region: 273-492
Classification Level Classification E-value
Superfamily vWA-like 4.08e-36
Family Integrin A (or I) domain 0.0048
Further Details:      
 
Domain Number 4 Region: 686-723
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000293
Family EGF-type module 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003117   Gene: ENSPPYG00000002672   Transcript: ENSPPYT00000003223
Sequence length 728
Comment pep:known_by_projection chromosome:PPYG2:10:113659280:113718265:1 gene:ENSPPYG00000002672 transcript:ENSPPYT00000003223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRFLLLETVCIFLFSRVMWCSAAVDIMFLLDGSNSVGKGSFERSKHFAITVCDGLDISP
ERVRVGAFQFSSTPHLEFPLDSFSTQQEVKARIKRMVFKGGRTETGLALKYLLHRGFPGG
RNASVPQILIIVTDGKSQGDVTLPAKQLKERGVTVFAVGVRFPRWEELHALASEPREQHV
LLADQVEDAINGLFSTLSSSAICSSATPDCRVEAHPCERRTLEMVREFAGNAPCWRGSRR
ARAVLAAHCPFYSWKRVFLTHPATCYRTTCPGPCDSQTCQNGGTCVPEGLDGYQCLCLFG
GEANCAPKLSLECRVDLLFLLDSSAGTTLDGFLRAKAFVKRFVQAVLSEDSRARVGVAVY
SRELLVVVPVGEYQDVPDLVRSLNGIPFRGGPTLTGSALRQAADRGFGSATRTGQDRPRR
VVVLLTESRSEDEVAGPAGHARARELLLLGVGSEAVRAELEEITGSPKHVMVYADPQDLL
NQIPELQGKLCSRPRPGCRTQALDLIFMLDTSASVGPENFAQMQSFVRSCALQFEVNPDV
TQVGLVVYGSQVQTAFGLDAKPTQAALLRAISQAPYLGGVGSAGTALLHIYDKVMTVQRG
ARPGVPKAVVVLTGGGGAEDAAVPAQKLRNNGISVLVVGVGPVLSEGLRRLAGPRDSLIH
VAAYADLRYHQDVLIEWLCGEAKRPVNLCKPSPCMNEGSCILQNGSYRCECRDGWEGPHC
ENRFLRVP
Download sequence
Identical sequences H2NBN8
ENSPPYP00000003117 9600.ENSPPYP00000003117 ENSPPYP00000003117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]