SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003174 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000003174
Domain Number 1 Region: 599-707
Classification Level Classification E-value
Superfamily SRCR-like 1.03e-46
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000572
Further Details:      
 
Domain Number 2 Region: 828-932
Classification Level Classification E-value
Superfamily SRCR-like 6.93e-46
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000523
Further Details:      
 
Domain Number 3 Region: 1087-1192
Classification Level Classification E-value
Superfamily SRCR-like 1.23e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000455
Further Details:      
 
Domain Number 4 Region: 491-596
Classification Level Classification E-value
Superfamily SRCR-like 1.7e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000523
Further Details:      
 
Domain Number 5 Region: 1219-1324
Classification Level Classification E-value
Superfamily SRCR-like 2.09e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000439
Further Details:      
 
Domain Number 6 Region: 100-205
Classification Level Classification E-value
Superfamily SRCR-like 2.88e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000562
Further Details:      
 
Domain Number 7 Region: 360-464
Classification Level Classification E-value
Superfamily SRCR-like 5.36e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000455
Further Details:      
 
Domain Number 8 Region: 720-825
Classification Level Classification E-value
Superfamily SRCR-like 5.62e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000432
Further Details:      
 
Domain Number 9 Region: 959-1062
Classification Level Classification E-value
Superfamily SRCR-like 6.93e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000479
Further Details:      
 
Domain Number 10 Region: 231-334
Classification Level Classification E-value
Superfamily SRCR-like 7.32e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000533
Further Details:      
 
Domain Number 11 Region: 1465-1572
Classification Level Classification E-value
Superfamily SRCR-like 3.27e-43
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000835
Further Details:      
 
Domain Number 12 Region: 1347-1459
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.29e-34
Family Spermadhesin, CUB domain 0.00028
Further Details:      
 
Domain Number 13 Region: 1589-1698
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.19e-33
Family Spermadhesin, CUB domain 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003174   Gene: ENSPPYG00000002717   Transcript: ENSPPYT00000003281
Sequence length 1995
Comment pep:known_by_projection chromosome:PPYG2:10:122171478:122241195:1 gene:ENSPPYG00000002717 transcript:ENSPPYT00000003281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGISTVILEMCLLWGQVLSTGGWIPRTTDYGSLIPSEAPLETAIVEGSPFPSELTLESTV
AEGSPISLESTLESTVAEGSLIPSESTLEPTVAEGSDSGLALRLVNGGNRCQGRVEVLYR
GSWGTVCDDSWDTSDANVVCKQLGCGWVMSAPGNARFGQGSGPIVLDDVRCSGHESYLWS
CPHNGWLSHNCGHGEDAGVICSAAQPQSTLRPESWPVGISPPVPTEGSESSLALRLVNGG
DRCQGRVEVLYQGSWGTVCDDNWDTNDANVVCRQLGCGWATSAPGNARFGRGSGPIVLDD
VRCSGRESYLWSCPHNGWLSHNCGHSEDAGVICSVSQSRPTPSPDTWPTSHALTAGSESS
LTLRLVNGGDRCQGRVEVLYGGSWGTVCDDSWDTSDANVVCRQLGCGWATSAPGNARFGQ
GSGPIVLDDVRCSGYESYLWSCPHNGWLSHNCQHSEDAGVICSAAHSWSTPRPDMLPTVT
LPASTVGSESSLALRLVNGSDRCQGRVEVLYRGSWGTVCDDSWDTNDANVVCRQLGCGWA
TSAPGNARFGRGSGPIVLDDVRCSGRESYLWSCPHNGWLSHNCGHGEDAGVICSGPESSL
ALRLVNGSDRCQGRVEVLYRGSWGTVCDDSWDTNDANVVCRQLGCGWAMSAPGNARFGRG
SGPIVLDDVRCSGNESYLWSCPHNGWLTHNCGHGEDAGVICSDTLPTTTLTASTVGPESS
LALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTNDANVVCRQLGCGWATSAPGNARFGQ
GSGPIVLDDVRCSGQESYLWSCPNNGWLSHNCGHGEDAGVICSGPESSLALRLVNGSDRC
QGRVEVLYRGSWGTVCDDSWDTSDANVVCRQLGCGWAMSAPGNARFGQGSGPIVLDDVRC
SGNESYLWSCPHNGWLTHNCGHGEDAGVICSAAQSRLTPRPDTLSTITLPPSTVGSESSL
TLRLVNGSDMCQGRVEVLYRGSWGTVCDDSWDTNDANVVCRQLGCGWATSASGNARFGQG
SGPIVLDDVRCSGHESYLWNCPHNGWLTHNCGHHEDAGVICSVSQSWPTPSLDTWPTSPA
STAGFESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTNDANVVCRQLGCGWATSA
PGNARFGQGSGPIVLDDVRCSGRESYLWSCPHNGWLTHNCGHGEDAGVICSAAQSQSTPR
PDTWLTTNLLASPIGSESSFALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTNDANVVC
RQLGCGWATSAPGNARFGQGSGPIVLDDVRCSGRESYLWSCPHNGWLTHNCGHREDAGVI
CSATQINSTTTDWWHPTTTTTARPSSNCGGFLFYASGTFSSPSYPAYYPNNAKCVWEIEV
NSGYRINLGFSNLQLEAHHNCSFDYVEIFDGSLNSSLLLGKICNDTRQIFTSSYNRMTIH
FRSDISFQNTGFLAWYNSFPSDATLRLVNLNSSYGLCAGRVEIYHGGTWGTVCDDSWTIQ
EAEVVCRQLGCGRAVSALGNAYFGSGSGPITLDDVECSGTESTLWQCRNRGWFSHNCNHH
EDAGVICSGNQLSTPAPFLNITRPNTNYSCGGFLSQPSGDFSSPFYPGNYPNNAKCVWDI
EVKNNYRVTVIFRDVQLEGGCKYDYIEVFDGPYHSSPLIARVCDGSRGSFTSSSNFMSIR
FISDHSITRRGFQAEYYSSPSNDSTNLLCLPNHMQASVSRSYLQSLGFSASDLVISTWNG
YHECRPQITPSLVIFTIPYSGCGTFKQADNDTIDYSNFLTAAASGGIIKRRTDLRIHVSC
RMLQNTWVDTMYIANGTTHIANDTIQVEEVQYGNFDVNISFYTSSSFLYPVTSHPYYVDL
NQDLYVQAEILHSDAALTLFVDTCVASPYSSDFTSLTYDLIRSGCVRDDTYGPYSPPSLR
IARFRFRAFHFLNRFPSVYLHCKMVVCRAYDPSSRCYRGCVVRSKRDVGSYQEKVDVVLG
PIQLQTPTRREEEPQ
Download sequence
Identical sequences H2NBU4
ENSPPYP00000003174 ENSPPYP00000003174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]