SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003196 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000003196
Domain Number 1 Region: 314-643
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 6.62e-71
Family Pancreatic carboxypeptidases 0.00000196
Further Details:      
 
Domain Number 2 Region: 136-296
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.73e-49
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00015
Further Details:      
 
Domain Number 3 Region: 643-731
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 1.86e-19
Family Carboxypeptidase regulatory domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003196   Gene: ENSPPYG00000002735   Transcript: ENSPPYT00000003303
Sequence length 756
Comment pep:known_by_projection chromosome:PPYG2:10:123373634:123523832:-1 gene:ENSPPYG00000002735 transcript:ENSPPYT00000003303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRPGTATPALALVLLAVTLAGVGAQGAALEDPDYYGQEIWSREPYYARPEPEPETFSPP
LPAGPGEEWERRPQEPRPPKRATKPKKAPKREKSAPEPPPPGKHSNKKVMRTKSSEKAAN
DDHNIRVAHEDFRESCPPLGLETLKITDFQLHASTVKRYGLGAHRGRLNIQAGINENDFY
DGAWCAGRNDLQQWIEVDARRLTRFTGVITQGRNSLWLSDWVTSYKVLVSNDSHTWVTVK
NGSGDMIFEGNSEKEIPVLNELPVPMVARYIRINPQSWFDNGSICMRMEILGCPLPDPNN
YYHRRNEMTTTDDLDFKHHNYKEMRQLMKVVNEMCPNITRIYNIGKSHQGLKLYAVEISD
HPGEHEVGEPEFHYIAGAHGNEVLGRELLLLLVQFLCQEYLAGNARIVHLVEETRIHILP
SLNPDGYEKAYEGGSELGGWSLGRWTHDGIDINNNFPDLNTLLWEAEDRQNVPRKVPNHY
IAIPEWFLSENATVAAETRAVIAWMEKIPFVLGGNLQGGELVVAYPYDLVRSPWKTQEHT
PTPDDHVFRWLAYSYASTHRLMTDARRRVCHTEDFQKEEGTVNGASWHTVAGSLNDFSYL
HTNCFELSIYVGCDKYPHESQLPEEWENNRESLIVFMEQVHRGIKGLVRDSHGKGIPNAI
ISVEGINHDIRTANDGDYWRLLNPGEYAVTAKAEGFTASTKNCMVGYDMGATWCDFTLSK
TNMARIREIMEKFGKQPVSLPARRLKLQGRKRRQRG
Download sequence
Identical sequences H2NBW5
XP_002821282.1.23681 9600.ENSPPYP00000003196 ENSPPYP00000003196 ENSPPYP00000003196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]