SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003231 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000003231
Domain Number 1 Region: 246-329
Classification Level Classification E-value
Superfamily E set domains 5.88e-20
Family E-set domains of sugar-utilizing enzymes 0.09
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000003231
Domain Number - Region: 336-386
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0121
Family HLH, helix-loop-helix DNA-binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003231   Gene: ENSPPYG00000002766   Transcript: ENSPPYT00000003339
Sequence length 579
Comment pep:known_by_projection chromosome:PPYG2:10:129596595:129728453:-1 gene:ENSPPYG00000002766 transcript:ENSPPYT00000003339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGLGSGMNPVRSWMHTAEGDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDR
QGQPVEIERTAFVDFVEKEKEPNNEKTNNGIHYKLQLLYSNGVRTEQDLYVRLIDSMTKQ
AIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQN
CLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEGTAPSY
LENATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVVFGTMLVWSELITPHAIRVQTPP
RHIPGVVEVTLSYKSKQFCKGAPGRFVYTALNEPTIDYGFQRLQKVIPRHPGDPERLPKE
VLLKRAADLVEALYGMPHNNQEIILKRAADIAEALYSVPRNHNQIPTLGNTPAHTGMMGV
NSFSSQLAVNVSETSQANDQVGYSRNTSSVSPRGYVPSSTPQQSNYNTVSTSMNGYGSGA
MANLGVPGSPGFLNGSSANSPYGIVPSSPTMAASSVTLPSNCSSTHGIFSFSPANVISAV
KQKSAFAPVVRPQASPPPSCTSANGNGLQAMSGLVVPPM
Download sequence
Identical sequences H2NC00
ENSPPYP00000003231 9600.ENSPPYP00000003231 ENSPPYP00000003231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]