SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003262 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000003262
Domain Number 1 Region: 13-336,452-498
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.7e-63
Family FAD-linked reductases, N-terminal domain 0.0053
Further Details:      
 
Domain Number 2 Region: 316-439
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.18e-29
Family L-aminoacid/polyamine oxidase 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003262   Gene: ENSPPYG00000002793   Transcript: ENSPPYT00000003370
Sequence length 511
Comment pep:known_by_projection chromosome:PPYG2:10:133097577:133113621:1 gene:ENSPPYG00000002793 transcript:ENSPPYT00000003370 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESTGSVGEAPGGPRVLVVGGGIAGLGAAQRLCGHSAFPHLRVLEATARAGGRIRSERSF
GGVVEVGAHWIHGPSRGNPIFQLAAEYGLLGEKELSEENQLVETGGHVGLPSVSYASSGA
RVSLQLVAEMATLFYGLIDQTREFLHAAETPVPSVGEYLKKEIGQHVAGWTEDEETRKLK
LAILNSFFNLECCVSGTHSMDLVALAPFGEYTVLPGLDCTFSKGYQGLTNCMMASLPEDT
VVFEKPVKTIHWNGSFQEAAFPGETFPVSVECEDGDRFPAHHVIVTVPLGFLKEHLDTFF
DPPLPAEKAEAIRKIGFGTNNKIFLEFEEPFWEPDCQLIQLVWEDTSPLEDAAPALQDAW
FQKLIGFVVLPAFASVHVLCGFIAGLESEFMETLSDEEVLLCLTQVLRRVTGNPRLPAPK
SVLRSRWHSAPYTRGSYSYVAVGSTGGDLDLMAQPLPADGAGAQLQILFAGEATHRTFYS
TTHGALLSGWREADRLLSLWAAQVQQPRPRL
Download sequence
Identical sequences H2NC31
ENSPPYP00000003262 ENSPPYP00000003262 9600.ENSPPYP00000003262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]